KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE2157Help
Entry
YE2157            CDS       T00469                                 

Gene name
sodB
Definition
(RefSeq) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Brite
Enzymes [BR:yen01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     YE2157 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2356988..2357566
Genome map
AA seq 192 aa AA seqDB search
MSFELPALPYAQNALEPHISAETLEYHYGKHHNTYVVNLNNLIKDTEFAGKSLEEIVKTS
SGGIFNNAAQVWNHTFYWHCLSPNGGGEPTGKVADAINQSFGSFAEFKAQFTDAAVKNFG
AGWTWLVKKTDGTLAIVSTSNAATPLTTADKPLLTVDVWEHAYYIDYRNARPKYLENFWA
LVNWSFVEKNLA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttgaattaccggcattaccttatgcacaaaatgcactggaaccgcacatttct
gctgaaacgctggaataccattacggcaagcaccacaacacctatgtggtaaacctcaat
aacctgatcaaggatactgagtttgcaggtaaatccttggaggagattgtcaaaacctcc
agtggcggtatttttaacaatgcagctcaagtttggaaccacaccttttactggcactgt
ttatcacctaatggcggcggcgaaccgacaggaaaagtcgccgatgccattaatcaatcc
tttggatcttttgctgaatttaaagcgcaatttactgatgcggcggtaaaaaactttggc
gcgggctggacctggctggtcaaaaaaacggatggcacgttagctattgtcagcacatca
aatgcggcgacaccgctgacgaccgctgataagccattgttaactgtagatgtatgggag
cacgcttactatattgattatcgtaatgcgcgaccaaaatatctggagaatttctgggcg
ctggtgaattggtctttcgttgagaaaaacttagcctga

DBGET integrated database retrieval system