KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C0116Help
Entry
YE105_C0116       CDS       T01480                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    YE105_C0116
  Energy metabolism
   00680 Methane metabolism
    YE105_C0116
Enzymes [BR:yep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     YE105_C0116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(137792..140431)
Genome map
AA seq 879 aa AA seqDB search
MNEQYSAMRSNVSMLGTLLGDTIKEALGEHILEKVETIRKLSKSSRAGNEASRQELLTTL
QNLSNDELLPVARAFSQFLNLTNTAEQYHSISPHGEAASNPEALAQLFTRLKDKKLSEQD
MRSAVDELSIELVLTAHPTEITRRTLIHKLVEVNTCLSQLDHNDLADYERNKIMRRLRQL
VAQSWHTDEIRKIRPSPVDEAKWGFAVVENSLWEGVPAFLREFNEQLQNSLDYRLPVEAV
PIRFTSWMGGDRDGNPNVTAEITRHVLLLSRWKATDLFLRDIQVLVSELSMSECTPELRE
LAGGEEVLEPYRELMKRVRTQLTNTQAYLEARLKGERVLPPTDLLVSNDQLWDPLYACYQ
SLKACGMEIIANGQLLDTLRRVRCFGVPLVRIDVRQESTRHTDAIAELTRYLGLGDYESW
SEADKQAFLIRELNSKRPLVPLKWEPSADTQEVLETCRVIAEAPQGSIAAYVISMAKVPS
DVLAVHLLLKEAGCPFTLPVAPLFETLDDLNNADDVMTQLLNIDWYRGLIQGKQMVMIGY
SDSAKDAGVMAASWAQYRAQDALIKTCEKAGISLTLFHGRGGSIGRGGAPAHAALLSQPP
GSLKGGLRVTEQGEMIRFKFGLPEVTISSLALYASAVLEANLLPPPEPKKEWNEVMDILS
DASCEMYRGYVRENPQFVPYFRAATPELELGKLPLGSRPAKRRPNGGVESLRAIPWIFAW
TQNRLMLPAWLGAGAGLQKAIDAGNKEVLATMCRDWPFFSTRIGMLEMVFAKADLWLAEY
YDQRLVDKSLWPLGQQLRDQLEADIKVVLAIANDDHLMADLPWIAESIALRNVYTDPLNV
LQAELLHRSRQQENAADARVEQALMVTIAGVAAGMRNTG
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcaatgcgaagtaacgtcagtatgctcggtacgctactcggg
gacaccatcaaggaagcacttggtgaacacatccttgaaaaagtagaaaccatccgtaaa
ttatctaaatcttcgcgtgccggtaatgaggcgagccgtcaggagctactgacgacactg
caaaatttatccaacgacgaactgctgccggtcgcccgtgcttttagccaattcctcaat
ctgacgaatacggcagagcaatatcacagcatttcgccgcatggtgaagccgcgagtaac
ccggaagctctggcccaactgttcacccgcttaaaagacaaaaagctgagtgagcaagac
atgcgcagcgcggttgatgagctatccattgagctggtgctaacggctcacccaacggaa
attacccgccgcaccttgattcataaactggttgaagtgaatacctgcctgagccagttg
gatcacaacgatttagccgattacgaacgcaacaagatcatgcgtcgtttgcggcagtta
gtcgcacaatcatggcatactgacgaaattcgtaaaatccgcccttccccggtcgatgaa
gctaaatggggctttgctgtggttgaaaacagcttatgggaaggtgtgcccgctttcctg
cgtgaatttaacgagcaattgcaaaactccctcgattatcgcttgccggtagaagcggtg
ccgatccgcttcacttcatggatgggtggcgaccgtgacggtaatccgaatgtcaccgct
gaaattacccgccatgtgctattactaagccgctggaaagcgaccgatttattcctgcgc
gacattcaggtattggtgtcagagctttctatgtcggaatgtacgccggaactgcgtgaa
ttggcgggcggcgaagaggtgctcgaaccttatcgtgaactgatgaaacgcgtgcgtact
cagttgaccaatactcaggcttatctggaagcacgtctgaaaggtgagcgcgtattgcca
ccaacagatttgctggtcagcaatgaccaattgtgggatccgctatacgcttgttatcaa
tccctgaaagcttgtggcatggaaatcatcgccaacggccagttactcgataccttacgc
cgcgtgcgctgttttggtgtgccattggtgcgtatcgatgtgcgtcaggaaagcacccgt
cataccgatgctattgctgaactgacccgctatctgggcctcggtgattatgaaagctgg
tctgaagcggacaaacaagccttcttgatccgcgaactgaactccaagcgcccactggtt
ccgctgaaatgggaacccagtgccgacacccaagaagtgttagaaacctgccgggtgatt
gccgaagcgccgcaaggttctatcgccgcttatgtgatttccatggcgaaagtgccatcg
gatgtgctggcggtgcatttactgctgaaagaagctggctgcccattcactctgccagtc
gcgccattgttcgaaacactcgatgacctgaacaatgcggacgacgtgatgacccagtta
ctgaatatcgactggtatcgcggcctgatccaaggcaagcagatggtgatgattggctat
tctgactcagcgaaagatgccggtgtaatggccgcgtcctgggcacaatatcgggcgcaa
gatgcgctaattaaaacctgcgagaaagccggtatctccctgacactgttccatggtcgc
ggcggttctatcggccgtggtggtgcacccgcccatgccgcgctactttctcagcctccg
ggcagcctgaaaggtggcttacgcgtgactgaacagggtgagatgatccgctttaagttt
ggtctgccggaagtcaccatcagcagtctggccctgtatgccagtgctgtactggaagcc
aatttgttaccgccgccggaaccgaagaaagagtggaatgaggtgatggatattctgtct
gatgcctcttgtgagatgtatcgcggctatgttcgtgaaaatccacagttcgttccttac
ttccgcgccgccacccctgaactggaattgggcaagctgccattgggttcgcgcccagcc
aaacgccgcccgaatggcggggtggaaagcctgcgtgctattccgtggatctttgcctgg
acacaaaaccgcctgatgttaccggcctggctgggggccggtgccggtttacagaaagcc
atcgatgccggtaataaagaagtattagccaccatgtgtcgtgactggccgttcttctca
acccgcattggtatgctggaaatggtgtttgccaaagccgatttgtggttggccgaatat
tatgaccagcgtctggtggataaatcattgtggccgttaggacagcaattacgcgaccaa
ctggaagccgatattaaagtggtgctggctatcgccaacgacgaccacttgatggcggat
ttaccgtggattgccgagtcgattgcactgcgtaacgtctataccgacccactaaacgtg
ttgcaagcggaactgttgcaccgctcgcgccagcaagaaaatgccgcagatgcccgtgtt
gagcaggcgttgatggtgactattgctggggtggcggcagggatgcgtaataccggttag

DBGET integrated database retrieval system