KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C3727Help
Entry
YE105_C3727       CDS       T01480                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    YE105_C3727
Enzymes [BR:yep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     YE105_C3727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
4281426..4282940
Genome map
AA seq 504 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRTGLFLYDHLGKRTSLPAS
KGLRFGPESVLKPELVRGFEYSDCWVDDARLVVLNAQEVVERGGEVRTRTKVTRAWREQG
LWMVEAVDANTGKIFTWRAKGLVNATGPWVKQFFDDGLKLKSPYGIRLIKGSHIVVPRVH
NQPQAYILQNEDHRIVFVIPWLDEYSIIGTTDVEYHGDPKDVKIDDQEIDYLLKVYNDHF
KKKLGRDDIVWTYSGVRPLCDDESDSPQAVTRDYTLDVADEGGKAPLLSVFGGKLTTYRK
LAEHALEKLSGYYPNVGPAWTKTGSLPGGDIGGSRDNYTVQLRHRYNWLPEGLARRYTRT
YGSHSELILADATSIESLGEHFGHGLYEAELRYLVEKEWVVELDDAIWRRTKLGMTLDDV
QKQRVAEWLAQVQAEKQQTLSLVS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagacttgatcgtgatcggtggcggcattaatggtgccggtatcgctgcg
gacgctgcagggcgtggcctgtccgttctgctgctggaagcacaagatttggcctgtgct
acgtcttctgccagctccaaacttatccacggtggtttacgttacctggaacactatgaa
ttccggttggtcagtgaagcattggccgaacgtgaggttttgctgaaactggctcctcat
atcgctttcccaatgcgctttcgcctgccccatcagccccatctgcgcccagcgtggatg
attcgtaccggcttattcttgtacgatcatttgggcaaacgtaccagcctgcctgccagt
aaagggctgcgctttggacccgaatcagtattgaagcccgagttagtgcgcggtttcgaa
tattctgattgctgggtagatgatgcccgcctggtagtgctgaatgctcaggaagtggtc
gaacgtggcggcgaagtacgtactcgcaccaaagtgactcgcgcctggcgtgaacaaggc
ctatggatggtggaagcggtcgatgccaacaccggcaaaatctttacctggcgcgccaaa
gggttagtcaatgctaccggcccgtgggttaaacagttctttgatgatggtctgaaactg
aaatcaccttatggtatccgcctgatcaaaggtagccatattgtggtgccacgggttcat
aaccaaccacaagcctatattctgcaaaacgaagaccaccgtattgtcttcgtcattcct
tggttggatgaatattccatcatcggtaccactgatgtggaataccacggcgatccgaaa
gatgtgaagatcgacgatcaggaaattgattacctgctgaaggtctataacgaccacttt
aaaaagaaactgggccgcgacgatatcgtctggacttactctggcgttcgtccgctgtgt
gatgatgaatcagattcaccgcaagcggttacccgtgattacacactggatgtcgccgat
gaaggtggcaaagcaccactgctatcagtatttggcggcaaactgaccacttaccgcaag
ctggcagaacatgcactggaaaaactgtccggctactatccaaatgtcggcccggcatgg
acgaaaaccggctcgttaccgggcggggatattggtggcagccgtgataactataccgtg
caattacgccatcgctataactggctgcctgaagggctggcgcgccgctatacccgtacc
tatggcagtcatagcgagctgattttggctgatgccaccagcatcgaaagcttgggcgaa
cacttcggccacggtctgtatgaagcagaattacgctatctggttgaaaaagagtgggtg
gttgaacttgatgatgcaatctggcgtcgcactaagttaggcatgactctggatgatgtg
cagaaacagcgagtggccgaatggctggcgcaagtacaagctgagaaacagcagaccctg
tctttggtctcctga

DBGET integrated database retrieval system