KEGG   Yersinia enterocolitica 2516-87: CH48_1987Help
Entry
CH48_1987         CDS       T03644                                 

Gene name
tuf
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
yet  Yersinia enterocolitica 2516-87
Brite
Translation factors [BR:yet03012]
 Eukaryotic Type
  Elongation factors
   CH48_1987 (tuf)
 Prokaryotic Type
   CH48_1987 (tuf)
Mitochondrial biogenesis [BR:yet03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CH48_1987 (tuf)
Exosome [BR:yet04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CH48_1987 (tuf)
  Exosomal proteins of breast cancer cells
   CH48_1987 (tuf)
  Exosomal proteins of colorectal cancer cells
   CH48_1987 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2221721..2222905
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGNARAFDQIDNAPEEKARG
ITINTSHVEYDTPSRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFMNKCDMVDDEELLELVEMEVRDLLSTYDFPGDDTPVVRGSALKALE
GEPEWEAKIIELAGYLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
EEVEIVGLKDTVKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREDIERGQVLAKPGSIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIQMI
VNLIAPIAMDDGLRFAIREGGRTVGAGVVAKVIE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgtacaaaaccgcacgttaatgtgggtactatcggccac
gttgaccatggtaaaactaccctaactgctgcaatcaccaccgttctggctaaaacctac
ggcggaaatgctcgtgcattcgaccaaattgacaacgctcctgaagagaaggcgcgtggt
atcaccatcaacacgtctcatgttgaatatgacaccccgtcacgtcactatgcgcacgtt
gactgcccagggcacgccgactacgttaaaaacatgatcaccggtgctgctcagatggat
ggcgctatcttggttgttgctgcaactgatggcccaatgccacagactcgtgagcacatc
ctgttgggtcgtcaggttggtgttccttacatcatcgtattcatgaacaaatgtgacatg
gttgacgatgaagagttgctggaactggtagaaatggaagtgcgcgatcttctgtctacc
tacgatttcccaggcgatgatacgccagttgttcgtggttcagcgctgaaagcattggaa
ggcgaacctgagtgggaagcaaaaattatcgaactggctggctacctggattcttacatc
ccagaaccagagcgtgctatcgataagccgttcctgctgccaatcgaagacgtattctct
atctctggccgtggtaccgttgtaacgggtcgtgtagagcgcggtattgttaaagttggc
gaagaagttgaaattgttggcctgaaagataccgttaaatctacttgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgcgggtgagaacgttggtgttctgctgcgt
ggtatcaagcgtgaagatatcgaacgtggtcaagttcttgctaaaccaggttctattaag
ccacacaccaaatttgaatcagaagtttatattctgagcaaagatgaaggtggccgccat
actccattctttaaaggctaccgtcctcagttctacttccgtacaactgatgtaaccggt
actattgaactgccagaaggcgttgagatggtgatgccaggcgataacattcaaatgatt
gttaacctgattgctcctatcgcaatggatgacggtttgcgcttcgcaattcgtgaaggc
ggtcgtactgtaggtgctggcgttgttgctaaagtcattgaataa

DBGET integrated database retrieval system