KEGG   Yersinia frederiksenii: AW19_1084Help
Entry
AW19_1084         CDS       T03606                                 

Definition
(GenBank) aldose 1-epimerase family protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
yfr  Yersinia frederiksenii
Pathway
yfr00010  Glycolysis / Gluconeogenesis
yfr01100  Metabolic pathways
yfr01110  Biosynthesis of secondary metabolites
yfr01120  Microbial metabolism in diverse environments
yfr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:yfr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AW19_1084
Enzymes [BR:yfr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     AW19_1084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AJI86717
UniProt: A0A0B6FQG5
LinkDB All DBs
Position
complement(1157926..1158804)
Genome map
AA seq 292 aa AA seqDB search
MNEKIFTLPVVEQISPYISQRQLDDLPIVVVSHPKVRAAVSLQGAHLLAYQPSGEQPVIW
LSNNTPFKNGVAIRGGVPICWPWFGPSAQPPHGFARLLPWTLSAHDENENGVILTFTLED
SDASRQFWPHPFTLIARFKLGEECEMELESHGDYEAVAALHTYFQIGDINQIKISGLGEK
YLDKVLKVADATQQGDLVFDGQTDRIYTQPETYSLIKDAALKRTIEVHHHHQSDVVAWNP
GAELSSSMVDMPNDGYKTMVCVETARVNKPLVATSDSPARLAMTIRSRKNSQ
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaaaatcttcaccctacctgttgttgaacaaatttcaccttacatcagtcag
cgtcagttggatgacctgccaattgtggtcgtttcccatccaaaagtacgtgccgcagtt
agcttgcaaggtgctcatttattggcttaccaaccaagcggtgaacaaccggttatctgg
ttgagcaataacacgccatttaaaaacggtgtcgctattcgtggtggtgtacccatttgt
tggccttggtttggcccatcagcgcaacctcctcatggttttgctcgtttactgccatgg
acgcttagcgcccatgatgagaatgaaaatggggttatcctgaccttcacactggaagac
agtgatgcatcccgtcaattctggccacatccattcactttgattgcccgcttcaagcta
ggtgaagaatgtgaaatggaattagaatcacacggcgattacgaagcggttgctgcgtta
catacttatttccagattggcgatatcaaccagattaagatcagtggcttaggcgaaaag
tatcttgataaagtgctgaaagtggctgatgccactcaacaaggcgatttggtgtttgat
ggtcagactgaccgaatttatacccagccagaaacttacagtttgataaaagatgccgcg
ctgaaacggaccattgaagtacatcatcatcatcaaagtgatgtggttgcatggaaccca
ggagcagagctgtccagcagcatggttgatatgccaaatgatggttataaaacaatggtt
tgtgtcgagactgcgcgtgtcaacaaacctttggttgcgacgtcagattcccctgctcgc
ctcgccatgaccatccgtagccgtaagaattctcaataa

DBGET integrated database retrieval system