KEGG   Yarrowia lipolytica: YALI0D21384gHelp
Entry
YALI0D21384g      CDS       T01033                                 

Definition
(RefSeq) YALI0D21384p
  KO
K10777  
DNA ligase 4 [EC:6.5.1.1]
Organism
yli  Yarrowia lipolytica
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:yli00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    YALI0D21384g
Enzymes [BR:yli01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     YALI0D21384g
DNA repair and recombination proteins [BR:yli03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     YALI0D21384g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
D:complement(2708566..2711436)
Genome map
AA seq 956 aa AA seqDB search
MSSERRPELEETAVDPATGSAASRKFSIVQDAVETTIVAPTNHGPSPRFSTLVRNLFEPL
VNLSAVVAALRKKPTEAKAHIASQFIKGWVEEVGKDIYPAFRLILPDKDRERAVYGLKEK
ALGRLWVKVLNLAKDSPDAKALSEWKQGGNESAGNFSKRCYEVLSKRTSLTDYGHMTVDE
VNERLDLLADGETDQAKQIEILTYFYKHMNATELKWLVNIILRQMKMNATEKVFFEPWHP
DAESLFNVTASLKRVCWELTDPTKRLTSAEAQVSLFACFMPQIAAFPKYSGQDIAGKHFK
GRPFYIEEKIDGERMQMHMSEYGNKFHWWSRRSKDFTETYGNSLDDASGSLTKRLRGIIN
PKVRNCVLDGEMVAYDPATKKIIPFGTLRTANRNEQNDLNLTKPMFMVFDILLLNDKPLV
DYTLAERKRTLRTIFARTDNETVGQEGVLEVLPYTEATTAAEIETCMRKIIAESSEGLVI
KDPTSVYRVNTRDDSWLKMKPEYMSEFGEKLDVVIIGGYYGSGKRGSILSSYLCGLRADG
SDQFWSFFKVGGGLTAGDYQAIRTKTEGKWKRWDKNDKPKNVLLAGPNGDLERPDVWIEP
SDSVVVEVKAASVVASDQYKVGLCLRFPRFRALRLDKTWEDGLTISQFAELRQTVEMEAE
NKELELEDRKRRNAGPGRGAKRLKLANVSSDEDELGTDERPTSVFKATSFAVLSDMSSPR
YMSKAAVENLIKKHGGTVFQTVEGPHTIPVADTRTIKVQALTKRVHGVDVIRPNWLLDCI
NEEKLVALEPRNLLESSAETLALAKTNVDEFGDSYTRPLTYKEMQEVLRFMDQFDLDQTN
PPDLMMEVLETNDGAVPKGMLFYGKKVYMSTSNMDTVALETQFRAYDALRCLQFGGANLV
TDMKDLVVAVAKTEEEAKELRRVSSEQVFPFRVVSIKWVEESWKNGTVEIEDDYPL
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcgagcggcgacccgagctggaagaaactgccgttgacccggcaacgggctct
gcggcgtctcgaaagttttccattgtccaggacgcggtggaaacgacaattgtggcaccg
accaaccatgggccctctcctcggttttccactctcgtccgcaacctgttcgagccgctg
gtcaatctctcggccgtggttgcagctctgcgcaagaaaccgaccgaggccaaggctcac
attgcctctcagttcatcaaggggtgggtagaggaggttggcaaggacatttatcctgcc
ttccgtctcatcttaccggacaaagaccgagaacgggccgtgtacgggctcaaggaaaag
gcgctgggccgtctgtgggtcaaggtgctcaatttggccaaagattcgcccgatgccaag
gcgttgagtgaatggaaacaaggaggcaacgaaagcgccggcaacttctccaaacggtgc
tacgaagtgctgagcaagcgaaccagtcttaccgactacggccatatgaccgtggacgag
gtcaatgagcgactggatcttttggccgacggagaaacggaccaggccaagcagattgag
attctaacctacttctacaagcacatgaacgccacggagctcaaatggctggtgaatatc
attttgcggcagatgaagatgaacgcgacggaaaaggtgttttttgagccctggcatccc
gatgccgagtccttgttcaacgtcactgccagtttgaaacgcgtctgctgggaattgaca
gatcctactaaacggctgacttccgcagaggcccaagtgtcgttattcgcctgtttcatg
ccgcaaatcgccgcgtttccgaaatactcgggccaggacattgccggaaaacacttcaag
ggcagaccgttctacattgaagaaaagattgacggagagagaatgcagatgcacatgagc
gaatatggcaacaagttccactggtggagcagacggtccaaggacttcaccgagacgtat
ggaaactctctggatgacgcttctggctctctgaccaaacgtcttagaggtatcatcaac
cccaaagtcagaaactgtgtgctggacggcgaaatggtggcttatgatcctgccaccaag
aagattatcccgtttggaactctgagaacggccaaccgaaacgaacagaacgacctgaac
ctcactaaacccatgttcatggtatttgacattcttttactcaacgataagcctctggtg
gactacactctagctgagcgcaagagaacacttcggaccatctttgcaaggactgataac
gagactgtgggtcaggaaggagttctggaagtgttaccctacaccgaggccaccaccgct
gctgaaatcgagacttgcatgcgaaagatcattgcagagtcgtccgaaggactggtcatc
aaagaccctacttctgtctacagggtgaacactcgagacgattcgtggctgaaaatgaaa
cctgagtacatgtctgaattcggcgagaagctcgatgttgtcattattggaggctactac
ggttcaggaaaacgaggcagtattctttcctcgtatctttgcggtcttcgggctgatgga
tcggaccagttttggtcctttttcaaagtggggggtggcctgactgcgggtgactaccag
gctattcgcaccaagaccgagggcaaatggaaacgatgggacaagaacgacaagcccaaa
aacgtgcttctggcgggccccaatggcgacctagaacgtccagatgtctggatcgagccg
tcggacagtgtggtggtcgaggtcaaggctgcttcagtagttgctagtgaccagtacaag
gtggggttgtgtctgcggtttcctagattccgagccctgcgactggataagacatgggaa
gacggactgaccatttctcagtttgcggagctcagacaaacagttgaaatggaggctgaa
aacaaggagttggagctggaggacagaaagagacgcaatgcaggtcccggaagaggggcc
aaacggctgaaactggcaaacgtgtcttctgacgaagacgagctgggtactgatgaaagg
ccgacgtctgttttcaaagccacgtcttttgctgtgctctcagacatgtcttctcctcgg
tacatgtctaaagccgcggtggaaaatctcatcaagaagcacggaggtactgtgtttcag
acggtcgaaggaccacacacgattcccgttgcagacacccgaactatcaaggtccaggct
ctgactaaacgggtccatggtgtggatgtgattcgacccaactggctgttggattgcatc
aacgaggagaaactagtggctctggagccgcgaaatctgctggagtcgagtgccgaaaca
cttgcacttgccaagacaaatgtcgacgagtttggagacagttacacccgccctctgacc
tacaaagagatgcaggaggtgttgcggttcatggaccagtttgatctggatcaaacaaac
ccccctgacttgatgatggaggttctggaaaccaatgatggagccgtgcccaagggaatg
ctcttctatggcaaaaaggtgtacatgtcgacttccaatatggacactgttgctctggag
acccagttcagagcctacgacgccttgagatgcctgcaatttggaggagccaatctcgtg
accgacatgaaagacctggtggtggcggttgccaaaacggaagaggaggctaaagagctg
agaagggtgtcctcggaacaggtgtttccgttcagagtggtgtccatcaagtgggtcgag
gagagctggaagaacggaacggtggagattgaggacgattaccctctataa

DBGET integrated database retrieval system