KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_1731Help
Entry
YPA_1731          CDS       T00369                                 

Definition
(GenBank) superoxide dismutase (Fe)
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Brite
Enzymes [BR:ypa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     YPA_1731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1941332..1941910
Genome map
AA seq 192 aa AA seqDB search
MSFELPALPYAQNALEPHISAETLEYHYGKHHNTYVINLNNLIKDTEFAGKSLEEIVKTA
NGGVFNNAAQVWNHTFYWHCLSPNGGGEPTGKIAEAINKSFGSFAEFKAQFTDAAVKNFG
AGWTWLVKKADGTLAIVSTSNAGTPLTTTDKPLLTVDVWEHAYYIDYRNARPKYLENFWA
VVNWSFAEKNLD
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttgaattacctgcattaccttacgcgcaaaatgcgctggaaccccacatctct
gccgaaacgctggaataccattatggtaagcaccacaacacctatgtgatcaacctcaat
aatctgattaaagatactgagtttgcaggcaaatcactggaagagatcgtgaaaaccgcc
aatggcggtgtgtttaataatgcggcccaagtttggaaccataccttctactggcattgc
ctgtcgccaaatggaggcggtgaacctactggaaaaatcgccgaggccattaataagtct
tttggctcatttgctgaatttaaagcgcaatttactgatgctgccgtgaaaaactttggc
gctggttggacgtggctcgttaaaaaagcggatgggacattggcgattgtcagtacttct
aacgcaggaacaccgctgacaacaacagataaacccctgttgaccgtcgatgtgtgggaa
catgcttactatattgattaccgtaatgcgcgaccaaaatatctggagaatttctgggca
gtagttaactggtctttcgctgagaaaaacctagactga

DBGET integrated database retrieval system