KEGG   Yersinia pseudotuberculosis IP 32953 (serotype 1): BZ17_2803Help
Entry
BZ17_2803         CDS       T03832                                 

Definition
(GenBank) FAD dependent oxidoreductase family protein
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ypo  Yersinia pseudotuberculosis IP 32953 (serotype 1)
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ypo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BZ17_2803
Enzymes [BR:ypo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BZ17_2803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3147785..3149299)
Genome map
AA seq 504 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRTGLFLYDHLGKRTSLPAS
KGLRFGPESVLKPELVRGFEYSDCWVDDARLVVLNAQEVVKHGGEVRTRTKVTRAWREQG
LWMVEALDVNTGKTFTWRAKGLVNATGPWVKQFFDDGLKLKSPYGIRLIKGSHIVVPRVH
NQPQAYILQNEDHRIVFVIPWLDDYSIIGTTDVEYHGDPKEVKIDDQEMTYLLKVYNDHF
KKQLGRDDIVWTYSGVRPLCDDESDSPQAVTRDYTLDVADEAGQAPLLSVFGGKLTTYRK
LAEHALEKLSAYYPNVGPAWTKTGALPGGDIGGSRDSYTVQLRHRYNWLPEGLARRYTRT
YGSHSELILANATRLESLGEHFGHGLYEAELRYLVENEWVVELDDAIWRRTKLGMALSDE
EKQRVAQWLADAHTEKQQALPLVS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagacttgatcgtgatcggtggcggtattaacggtgccggtatcgctgcg
gacgctgctgggcgtggcctgtcggtactgctgctggaagcgcaagacttggcctgtgct
acgtcttccgccagttccaaacttatccatggtggcttacgctatctggaacattatgaa
ttccgcttggtaagtgaagccttggccgagcgtgaagtgttactgaaactggcaccgcat
atcgcattccctatgcgcttccgcctaccccaccagcctcatctgcgcccggcatggatg
atccgcaccggcttgttcttgtatgaccatttgggcaaacgtaccagcctgccagccagt
aaagggctgcgttttgggccggaatctgtgttaaaacccgagttggtgcgcggtttcgaa
tattctgactgttgggtggatgatgcccgcctggtggtgctgaatgcgcaggaagtggtt
aaacacggcggtgaagtccgaacccgtaccaaagtgacccgtgcctggcgtgaacaaggc
ctatggatggttgaagcccttgatgtcaatactggcaaaaccttcacctggcgggctaaa
ggcttagtgaatgccactggcccttgggttaaacagttcttcgacgatggcctaaagctc
aaatcaccttatggcatccgcctaattaaaggcagccacattgtggtgccccgggttcat
aaccaaccgcaggcgtatattctgcaaaatgaagatcaccgtatcgttttcgttatccct
tggttagatgactattccatcatcggtactaccgacgtggaataccacggcgatccaaaa
gaggtgaaaattgacgatcaggaaatgacttatctgctgaaagtctataacgaccacttt
aaaaaacagttgggtcgtgacgatatcgtctggacctactctggtgtgcgcccgctatgc
gacgatgaatcagattcaccgcaagccgttacccgcgattacacgctagatgtggccgat
gaagcgggtcaggcaccactcctgtcggtcttcggcggtaaactcaccacctaccgtaaa
ttggcagaacatgcgctggaaaaactgtcagcgtactacccgaatgtcggcccagcgtgg
actaaaaccggtgccttgcccggtggggatattggcggtagccgtgatagctataccgtg
caattgcgccaccgctataactggttgccggaaggattggcccgccgctatacccgtacc
tatggtagccacagcgagctaattttagccaatgcgacccgtcttgaaagcctgggtgag
cactttggtcacggcttgtatgaggctgaattgcgctatttggttgagaacgagtgggtc
gttgagctggatgatgctatctggcgccgtaccaaattaggcatggccctcagcgatgaa
gagaaacagcgggtagcccagtggctggctgatgcgcacactgaaaaacaacaggcgctg
ccgctggtttcttaa

DBGET integrated database retrieval system