KEGG   Yersinia pseudotuberculosis IP 32953 (serotype I): YPTB3702Help
Entry
YPTB3702          CDS       T00195                                 

Gene name
tufA
Definition
(GenBank) elongation factor EF-Tu
  KO
K02358  
elongation factor Tu
Organism
yps  Yersinia pseudotuberculosis IP 32953 (serotype I)
Brite
Translation factors [BR:yps03012]
 Eukaryotic Type
  Elongation factors
   YPTB3702 (tufA)
 Prokaryotic Type
   YPTB3702 (tufA)
Mitochondrial biogenesis [BR:yps03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    YPTB3702 (tufA)
Exosome [BR:yps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YPTB3702 (tufA)
  Exosomal proteins of breast cancer cells
   YPTB3702 (tufA)
  Exosomal proteins of colorectal cancer cells
   YPTB3702 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4398811..4399995)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPARHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFMNKCDMVDDEELLELVEMEVRELLSAYDFPGDDLPVVRGSALKALE
GEAEWEAKIIELAGYLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
EEVEIVGIKDTVKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREDIERGQVLAKPGSIK
PHTTFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNINMI
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaaatttgaacgtaccaaaccccatgtaaacgtcggtactatcggccac
gttgaccatggtaaaactaccctgacagcagcaatcaccaccgttctggctaaaacctac
ggcggtagcgctcgtgctttcgatcaaatcgataacgcaccagaagaaaaagcacgtggt
atcaccatcaacacttctcacgttgaatatgatactcctgctcgtcactatgcgcacgtt
gactgcccaggtcacgccgactatgttaaaaacatgatcaccggtgctgctcagatggat
ggtgcaatcctggttgttgctgcaactgatggccctatgccacagactcgtgagcacatc
ctgttgggtcgtcaggttggcgttccttacatcatcgtattcatgaacaaatgtgacatg
gttgatgatgaagagctgctggaactggtagaaatggaagttcgtgaacttctgtctgct
tacgacttccctggcgatgatctgccagttgttcgtggttcagcgctgaaagcactggaa
ggcgaagctgagtgggaagctaaaatcatcgaactggctggttacctggattcttatatc
ccagaaccagaacgtgctatcgacaagccgttcctgctgccaatcgaagacgtattctct
atctcaggccgtggtactgtagtaactggtcgtgtagagcgcggtatcgttaaagtcggc
gaagaagttgaaatcgtcggtatcaaagatactgttaaatctacttgtactggcgttgaa
atgttccgcaaattgctggacgaaggccgtgctggtgagaacgttggtgttctgctgcgt
ggtatcaaacgtgaagatatcgaacgtggtcaagttctggctaaaccaggttctatcaaa
ccacacactacctttgaatcagaagtttatattctgagcaaagatgaaggcggccgtcat
actccgttcttcaaaggctaccgtcctcagttctacttccgtacaactgacgtaaccggt
accatcgaattgccagaaggcgttgaaatggtgatgccaggtgacaacatcaacatgatt
gttaccctgattcacccaatcgcaatggacgacggcttgcgtttcgcaatccgtgaaggc
ggccgtactgtaggcgctggtgttgttgctaaagtaatcgcttaa

DBGET integrated database retrieval system