KEGG   Yersinia pestis Shasta: BZ15_1141Help
Entry
BZ15_1141         CDS       T03718                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase Fe
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ypv  Yersinia pestis Shasta
Brite
Enzymes [BR:ypv01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BZ15_1141 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AJJ52753
UniProt: Q0WED6 A0A0H2W6I9
LinkDB All DBs
Position
complement(1249008..1249586)
Genome map
AA seq 192 aa AA seqDB search
MSFELPALPYAQNALEPHISAETLEYHYGKHHNTYVINLNNLIKDTEFAGKSLEEIVKTA
NGGVFNNAAQVWNHTFYWHCLSPNGGGEPTGKIAEAINKSFGSFAEFKAQFTDAAVKNFG
AGWTWLVKKADGTLAIVSTSNAGTPLTTTDKPLLTVDVWEHAYYIDYRNARPKYLENFWA
VVNWSFAEKNLD
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttgaattacctgcattaccttacgcgcaaaatgcgctggaaccccacatctct
gccgaaacgctggaataccattatggtaagcaccacaacacctatgtgatcaacctcaat
aatctgattaaagatactgagtttgcaggcaaatcactggaagagatcgtgaaaaccgcc
aatggcggtgtgtttaataatgcggcccaagtttggaaccataccttctactggcattgc
ctgtcgccaaatggaggcggtgaacctactggaaaaatcgccgaggccattaataagtct
tttggctcatttgctgaatttaaagcgcaatttactgatgctgccgtgaaaaactttggc
gctggttggacgtggctcgttaaaaaagcggatgggacattggcgattgtcagtacttct
aacgcaggaacaccgctgacaacaacagataaacccctgttgaccgtcgatgtgtgggaa
catgcttactatattgattaccgtaatgcgcgaccaaaatatctggagaatttctgggca
gtagttaactggtctttcgctgagaaaaacctagactga

DBGET integrated database retrieval system