KEGG   Yersinia rohdei: CH64_2704Help
Entry
CH64_2704         CDS       T03610                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
yro  Yersinia rohdei
Pathway
yro00620  Pyruvate metabolism
yro00680  Methane metabolism
yro01100  Metabolic pathways
yro01120  Microbial metabolism in diverse environments
yro01200  Carbon metabolism
Module
yro_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:yro00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CH64_2704
  Energy metabolism
   00680 Methane metabolism
    CH64_2704
Enzymes [BR:yro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CH64_2704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AJJ11726
UniProt: A0A0U1HVM8
LinkDB All DBs
Position
complement(3013920..3016556)
Genome map
AA seq 878 aa AA seqDB search
MNEQYSAMRSNVSMLGTLLGDTIKEALGEHILDRVETIRKLSKSSRAGNEASRQELLTTL
QNLSNDELLPVARAFSQFLNLTNTAEQYHSISPHGEAASNPEALAQLFTRLKDKKLSEQD
MRNAVDELSIELVLTAHPTEITRRTLIHKLVEVNTCLSQLDHNDLADYERNKIMRRLRQL
VAQSWHTDEIRKIRPSPIDEAKWGFAVVENSLWEGVPAFLREFNEQLQNSLDYRLPVEAV
PIRFTSWMGGDRDGNPNVTAEITRHVLLLSRWKATDLFLRDIQVLVSELSMSECTPELRK
LAGGEEVLEPYRELMKRVRTQLTNTQTYLESRLKGERVLPPTDLLVSNDQLWDPLYACYQ
SLKSCGMEIIANGQLLDTLRRVRCFGVPLVRIDVRQESTRHTDAIAELTRYLGLGDYESW
SEADKQAFLIRELNSKRPLVPLKWEPSADTQEVLETCRVIAEAPQGSIAAYVISMAKVPS
DVLAVHLLLKEAGCPFTLPVAPLFETLDDLNNADEVMTQLLSIDWYRGLIQGKQMVMIGY
SDSAKDAGVMAASWAQYRAQDALIKTCEKAGISLTLFHGRGGSIGRGGAPAHAALLSQPP
GSLKGGLRVTEQGEMIRFKFGLPEVTISSLALYAGAILEANLLPPPEPKKEWIEVMDLQS
EASCEMYRGYVRENPEFVPYFRAATPELELGKLPLGSRPAKRRPNGGVESLRAIPWIFAW
TQNRLMLPAWLGAGAGLQKAIDAGKKDVLATMCRDWPFFSTRIGMLEMVFAKADLWLAEY
YDQRLVDKSLWPLGQQLRDQLAADIKVVLAIANDDHLMADLPWIAESIALRNVYTDPLNV
LQAELLHRSRQQEHPDARVEQALMVTIAGVAAGMRNTG
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcaatgcgaagtaacgtcagtatgctcggcacactactcgga
gacacaatcaaggaagcgctaggcgagcatattcttgatagggtagaaaccatccgtaaa
ttatctaaatcttcgcgtgccgggaatgaagccagccgtcaggaattgctgacgacgctg
caaaatctgtccaacgacgaactgctgccagtagcccgtgcttttagccaatttctcaat
ctgaccaatacagcagagcaatatcacagcatttcgccacatggcgaagccgcaagtaat
ccagaagccctggcccaactgttcacccgcttaaaagacaaaaagctgagcgaacaagat
atgcgcaacgcggttgatgagttatccatcgaactggtattaactgctcatccgaccgaa
atcacccgccgtactttgatccataaactggtagaagtgaatacctgcctgagccagttg
gatcacaatgatttggccgattacgaacgcaacaagatcatgcgtcgtttacggcagtta
gtagcacaatcatggcatactgacgaaattcgtaaaattcgcccttcccctattgatgaa
gcaaaatggggctttgcggttgttgaaaacagcttgtgggagggggttcctgctttcctg
cgcgagtttaacgaacagctacaaaattctcttgattaccgcttaccggtagaagccgtg
ccaattcgcttcacctcatggatgggcggtgaccgcgacggtaacccaaatgttaccgca
gaaattacccgccacgtgttgttactgagccgctggaaggcgactgatttgttcctgcgc
gatattcaggtgttggtatccgagctgtcaatgtcggaatgtacaccagaactgcgcaaa
ctggctggcggcgaagaggtgctcgagccttatcgtgaactgatgaagcgcgtgcgcacc
cagttgaccaacactcaaacctatctggaaagccgcctgaaaggcgagcgcgtgttgccg
ccaactgatttgctggtcagcaatgaccaactgtgggatccgctctacgcctgttatcaa
tcactgaaatcctgtggcatggaaatcatcgccaacggccaattgctggataccttgcgc
cgcgtgcgctgttttggtgtgccattggtgcgtatcgatgtgcgccaggaaagtacccgt
cacaccgatgccattgctgaattgacccgctatctgggccttggtgactatgaaagctgg
tctgaggccgataaacaagccttcctgatccgcgagctgaactctaagcgcccattggtg
ccactgaaatgggaaccgagcgccgatacccaagaagtgctggaaacctgccgggtcatt
gctgaagcaccgcaaggctctatcgccgcgtatgttatctcgatggccaaagtgccatca
gacgtgcttgcggtgcatttgctgctaaaagaagccggttgcccattcactctgcccgtc
gcgccattgttcgaaacccttgatgatctaaacaacgccgacgaagtaatgacccagttg
ctgagtattgactggtatcgcggcctgatccaaggcaagcaaatggtgatgattggttat
tctgactcggcaaaagatgccggcgtgatggcggcctcttgggcgcaatatcgtgcgcaa
gatgccttaatcaaaacctgtgagaaagccggtatttccctgacattgttccacggccgt
ggcggttctattggtcgcgggggcgcacctgctcatgcagccctgctctctcagcctccg
ggtagcctgaaaggtggcttacgggtcaccgaacaaggcgaaatgatccgctttaaattt
ggtttgccggaagtcactatcagcagtttggcgctgtacgccggtgctattcttgaagcc
aatctattaccgccgccagaaccgaagaaagaatggattgaggtgatggatttgcagtct
gaagcctcttgcgaaatgtatcgtggttatgtgcgagagaatccagagttcgtcccttac
ttccgggccgccacaccagagctggagctaggtaaattgccattgggttctcgcccggca
aaacgccgcccgaacggcggagtagagagcctgcgtgccatcccttggattttcgcctgg
acacaaaaccgcctgatgctgcccgcctggttgggtgccggtgcaggtttgcagaaagct
atcgatgccggtaagaaagacgtcttagccacgatgtgtcgggactggccgttcttctct
actcgcattggcatgctggaaatggtcttcgctaaagcggatttgtggctggctgaatat
tacgatcagcgcttggtggataaatcattgtggccgttaggtcagcaattgcgcgaccaa
ttagccgctgatattaaagtggtgttggccattgccaacgatgaccatttaatggctgat
ttgccgtggattgccgaatctatcgcattacgtaatgtgtataccgacccattaaacgtc
ctgcaagccgagctattacaccgttcgcgccagcaagaacacccagatgcccgcgttgag
caagcattgatggtgaccattgccggtgttgcggcagggatgcggaatacaggttag

DBGET integrated database retrieval system