KEGG   Yersinia similis: BF17_06780Help
Entry
BF17_06780        CDS       T03057                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ysi  Yersinia similis
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ysi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BF17_06780 (glpD)
Enzymes [BR:ysi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BF17_06780 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1373922..1375436
Genome map
AA seq 504 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLRLAPHIAFPMRFRLPHQPHLRPAWMIRTGLFLYDHLGKRTSLPAS
KGLRFGPESVLKPELVRGFEYSDCWVDDARLVVLNAQEVVKRGGEVRTRTKVTRAWREQG
LWMVEALDVNTGKTFTWRAKGLVNATGPWVKQFFDDGLKLKSPYGIRLIKGSHIVVPRVH
NQPQAYILQNEDHRIVFVIPWLDDYSIIGTTDVEYHGDPKEVKIDDQEIAYLLKVYNDHF
KKQLGRDDIVWTYSGVRPLCDDESDSPQAVTRDYTLDVADEAGQAPLLSVFGGKLTTYRK
LAEHALEKLSAYYPNVGPAWTKTGALPGGDIGGSRDSYTVQLRHRYNWLPEGLARRYTRT
YGSHSEIILANATSLESLGEHFGHGLYEAELRYLVENEWVVELDDAIWRRTKLGMALSDE
EKQRVAQWLADTHTEKQQALPLVS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagacttgatcgtgatcggtggcggtattaacggggccggtatcgctgcg
gacgctgcagggcgtggcctgtcagtactgctgctagaagcgcaagacttggcctgtgct
acgtcttccgccagttccaaacttatccatggtggcttgcgctatctggaacattatgaa
tttcgcttggtaagcgaagccttggccgagcgtgaagtgttactgagactggcaccgcat
atcgcattccctatgcgcttccgcctgccccaccagcctcatctacgcccggcatggatg
atccgcaccggcttgttcttgtatgatcatttgggcaaacgtaccagcctgccagccagt
aaagggctgcgtttcggcccggaatctgtgttaaaacccgagttggtgcgcggtttcgaa
tattctgactgttgggtggatgatgcccgcctggtggtactgaatgcgcaggaagtggtc
aaacgcggcggtgaagtccgtacccgtaccaaagtaacccgcgcatggcgtgaacaaggc
ctatggatggttgaagcccttgatgtcaataccggcaaaaccttcacctggcgtgctaaa
ggcctagtgaatgccactggcccttgggttaaacagttcttcgacgatggcctaaagctc
aaatcaccttatggcatccgcctgattaaaggcagccacattgtggtgcctcgagttcat
aaccaaccgcaggcgtatattctgcaaaatgaagatcaccgtatcgtcttcgtgatccct
tggttagatgactattccatcatcggtactaccgacgtggaatatcacggcgatccaaaa
gaggtgaaaattgacgatcaggaaattgcttatctgctaaaagtctataacgaccacttt
aaaaagcagttgggccgtgatgatatcgtctggacctactctggtgtgcgcccgctatgc
gacgatgaatcagattcaccgcaagccgttacccgcgattacacgttagatgtggccgat
gaagcgggtcaggcaccactcctgtcggtcttcggcggtaaactcaccacgtaccgtaaa
ttggcagaacatgcgctggaaaaactgtcagcgtactacccgaatgtcggcccggcgtgg
actaaaaccggtgccttgcccggtggggatattggcggtagccgcgatagctataccgtg
cagttgcgccaccgctataactggttgccggaagggctggcccgccgctatacccgtacc
tatggtagccacagcgagataattttagccaacgcgaccagtcttgaaagcttgggcgag
cactttggtcacggcttgtatgaggccgaattgcgctatttggttgagaacgagtgggtt
gttgagctggatgatgctatctggcgccgtaccaaattaggcatggccctcagcgatgaa
gagaaacagcgggtagcccagtggctggctgatacgcacactgaaaaacaacaggcgcta
ccgctggtttcttaa

DBGET integrated database retrieval system