KEGG   Ziziphus jujuba (Chinese jujube): 107415793Help
Entry
107415793         CDS       T04794                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju00250  Alanine, aspartate and glutamate metabolism
zju00410  beta-Alanine metabolism
zju00430  Taurine and hypotaurine metabolism
zju00650  Butanoate metabolism
zju01100  Metabolic pathways
zju01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zju00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    107415793
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107415793
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107415793
   00430 Taurine and hypotaurine metabolism
    107415793
Enzymes [BR:zju01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     107415793
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Met_gamma_lyase
Motif
Other DBs
NCBI-GeneID: 107415793
NCBI-ProteinID: XP_015879672
LinkDB All DBs
Position
4
AA seq 502 aa AA seqDB search
MVLSKTFSESDVSIHSTFASRYVRTSLPRFKIPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMDSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGESEAAVG
VGTVGSSEAIMLAGLAFKRKWQNKMKAQGKPFDKPNIVTGANVQVCWEKFARYFEVELKE
VKLRDGYYVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKLLNDLLEKKNKETGWDTP
IHVDAASGGFIAPFIYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRTKDDLPDEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGHEGYRNVMENCRENMIVLKEGLER
TGRFNIVSKDNGVPLVAFSLKDNQRHDEFEVSDFLRRFGWIVPAYTMPPDAQHVTVLRVV
IREDFSRTLAERLVIDIQKVLHELDTLPAKINAKYSDSGNEEVVKVNNGNLVTKKSDIET
QREITTIWKKFVLERKKMNGVC
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggttctctccaagactttctcagagtccgatgtatccatccactccacgttcgcttct
cgatatgttagaacctctcttcccaggttcaagataccggagaattcgataccgaaagag
gcagcgtaccagatcataaacgatgagctgatgctcgatggcaaccctagactgaacttg
gcgtcgttcgtgacgacgtggatggagcctgagtgtgataagctcatcatggactccatt
aacaagaactacgtcgacatggatgagtaccctgttaccactgagctccagaaccggtgt
gtgaacatgatagcacacctattcaatgcaccgctgggcgaatcagaagcagcggtggga
gtgggaacggtggggtcctccgaggccatcatgttggcaggtttggcgttcaagaggaag
tggcagaacaaaatgaaagcccaaggcaaaccctttgacaagcccaacattgttaccgga
gccaatgtccaggtgtgctgggagaaatttgcaaggtactttgaggtggagttgaaggag
gtgaagctaagggatggttattatgtgatggaccccgagaaagctgtggagatggttgat
gagaacaccatctgtgttgctgcaattctcggttcaactctcaatggagaattcgaggat
gtaaagctcctaaatgatctcttggaaaagaagaataaggaaacagggtgggatactcca
atccatgtggacgcagcaagtggagggtttatagcaccatttatatacccagagcttgaa
tgggatttcaggcttccattggtgaagagcatcaatgtgagtgggcacaagtatgggctt
gtgtacgctggaattgggtgggtcatctggaggaccaaagacgacttgcctgacgaactc
attttccatattaactatcttggagctgaccaacccactttcaccctcaacttctccaaa
ggttccagccaagttattgctcagtattatcagctcattcgtttaggtcatgagggttat
aggaacgtgatggaaaactgcagggaaaacatgatagtgcttaaagaaggattggagagg
acaggaaggttcaacattgtctcaaaggacaatggagtaccattggtggctttctcattg
aaagacaaccagcgccacgacgagttcgaggtctctgacttccttcgtcgctttggatgg
attgttccggcctacaccatgccgccggatgctcagcacgtgacggtgcttcgtgttgtg
atcagagaagatttctctcgtactttggctgagcgccttgtgattgatattcagaaagtt
ctgcatgaactcgacaccctgcctgccaagatcaatgccaagtattcggattctggtaat
gaggaggttgtgaaagttaataatggtaacttggttaccaagaaaagtgatattgagact
caaagggagatcactaccatttggaagaagtttgtgttggaaaggaagaagatgaacggt
gtgtgttaa

DBGET integrated database retrieval system