KEGG   Zea mays (maize): 542764Help
Entry
542764            CDS       T01088                                 

Gene name
sod3
Definition
(RefSeq) superoxide dismutase [Mn] 3.1, mitochondrial precursor
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
zma  Zea mays (maize)
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:zma00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    542764 (sod3)
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     542764 (sod3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6
AA seq 235 aa AA seqDB search
MALRTLASKKVLSFPFGGAGRPLAAAASARGVTTVTLPDLSYDFGALEPAISGEIMRLHH
QKHHATYVANYNKALEQLETAVSKGDASAVVQLQAAIKFNGGGHVNHSIFWKNLKPISEG
GGEPPHGKLGWAIDEDFGSFEALVKKMNAEGAALQGSGWVWLALDKEAKKVSVETTANQD
PLVTKGASLVPLLGIDVWEHAYYLQYKNVRPDYLNNIWKVMNWKYAGEVYENVLA
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggctctccgcaccctggcatcgaagaaggtcctatccttcccgttcggcggcgcgggc
cggccgttggcggcggcggcgtctgcgaggggggtgacgacggtcacactccccgacctc
tcctacgacttcggcgcgctggaaccggccatctcgggggagatcatgcgcttgcaccac
caaaagcaccacgccacctacgtcgccaactacaacaaggcgctggagcagcttgaaact
gccgtctccaagggcgacgcctccgctgtcgtccagctgcaggcggcgatcaagttcaac
ggcggcggtcatgtgaaccattcaatcttctggaagaacctcaagcccattagcgaaggt
ggcggggagccgcctcatgggaaacttggctgggccatcgatgaggattttggttcgttt
gaggcacttgtaaagaagatgaatgcagaaggcgctgctttacaagggtctggatgggtg
tggttagctttggataaagaggcaaaaaaggtttcagttgaaacaacagctaatcaggat
cctctggtgactaaaggtgcaagcttggttccgctgttggggattgatgtctgggaacat
gcatactacctgcagtacaagaatgttaggccggattacctgaacaacatctggaaggtg
atgaactggaaatatgctggagaggtgtacgaaaatgttcttgcttga

DBGET integrated database retrieval system