KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_0207Help
Entry
Zmob_0207         CDS       T01875                                 

Definition
(GenBank) Glutathione S-transferase domain-containing protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:zmm00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Zmob_0207
Enzymes [BR:zmm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Zmob_0207
Transporters [BR:zmm02000]
 Other Transporters
  Pores ion channels [TC:1]
   Zmob_0207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(231565..232236)
Genome map
AA seq 223 aa AA seqDB search
MWQLYQFPLCPFSRKVRFLLGEKGIGYELIRESPWLKRDEFVDMNPAGQTPVMVDSSAPV
ILVDSQVICEFLEETVDRMPLISGTAVHRAEIRRLVSLFDNKLYFEVTAPLMNERMLKRL
VHRQAPDAAILRGAMKNANSHLDYIDWLLDHRRWLAGPVLSLADFAAAAQISVSDYLGGV
DWRGHENSREWYAAMKSRPSFQPILAERMEVILPPDHYDQPDF
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagctttatcagtttcctctttgccctttttccagaaaggtgcgttttctcctt
ggtgaaaaagggatcggctatgagttgatccgtgaatccccatggctaaaaagagatgaa
ttcgtcgatatgaatccagccggtcaaacgccggttatggtagatagttctgcgcctgtt
attctggtggattcacaggttatctgtgaatttctggaagaaacagtcgatcggatgccg
cttatcagcggaacagccgtgcatagggctgaaataaggcgtttggtttctctctttgat
aacaaactttattttgaagtcaccgcgcctttaatgaatgagcggatgctgaaaaggttg
gttcatcgtcaggcaccggatgccgcaattttgcggggtgccatgaaaaacgccaatagc
catctcgattatattgattggttattggatcatcgtcgttggttggcggggcctgtttta
agtttggcggattttgcggcagcggcacaaatttcggtttccgattatcttggtggcgtt
gattggcgcggtcacgaaaatagtcgcgaatggtatgcggcaatgaagtcccgcccttct
ttccaacctattttagcagagagaatggaggttattttgcctccagatcattacgaccag
ccagatttctaa

DBGET integrated database retrieval system