KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_0454Help
Entry
Za10_0454         CDS       T01110                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:zmn00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Za10_0454
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Za10_0454
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Za10_0454
Enzymes [BR:zmn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Za10_0454
Peptidoglycan biosynthesis and degradation proteins [BR:zmn01011]
 Precursor biosynthesis
  Amino acid ligase
   Za10_0454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
LinkDB All DBs
Position
complement(532887..533852)
Genome map
AA seq 321 aa AA seqDB search
MSDKKHVVVLMGGWSSEREISLLSGRHVGKALEEAGYRVTLLDMDRDIAFKLREAKPDVV
FNALHGTPGEDGSIQGLMDLMAIRYTHSGLTASAIAIDKELTKKILTPENIPMPQGCLVE
RESLYTKDPLPRPYVLKPVNEGSSVGVAIIDESFNDGQPIRKDQIDPWKNFKTLLAEPFI
KGRELTVAVMGDKALAVTELCPNNGFYDYKAKYTDGMTTHICPAKIPAEIAEKAMALSLK
AHQLLGCRGPSRSDFRWDDEAGLDGLFLLEVNTQPGMTPLSLVPEQAKQLGIDYVALCRM
IVEEALAEDTLQETKMAGQGG
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaaaaagcatgttgtcgttttgatgggcggatggtcttcggaacgtgaaatt
tcgcttctgtcaggccgccatgtcggcaaggctttggaagaggctggatatcgcgttacg
ctgcttgatatggatcgggatattgcgttcaagcttcgtgaagctaagccggatgtggtt
tttaatgctttgcatggcacgccgggtgaagatggcagtattcaaggtctgatggattta
atggctatccgttatacccattcgggtttgacggcttcggccattgccattgataaagaa
ttgaccaaaaagattctgacccctgagaatattccgatgccgcagggctgtttggttgag
cgcgaaagcctttatacaaaagacccgttgccacgaccttatgtcttgaaaccggtcaat
gaaggctcttctgtcggcgttgcgatcattgatgaatcttttaatgacggtcagcctatt
cggaaagaccagattgatccgtggaaaaattttaaaacccttcttgccgaaccttttatt
aaagggcgggaattaaccgtggcggtgatgggtgacaaagccttggctgttaccgaatta
tgcccgaataacggcttttacgattataaagccaaatatactgatggcatgacaacccat
atctgtcctgcaaaaattccggcagagattgccgaaaaggcgatggctctttccttgaaa
gcgcatcaacttttgggatgtcggggcccgtcgcgttccgattttcgttgggatgatgaa
gccggattggatggtttgtttctgttagaggtgaatacccagccgggtatgacacctttg
agtttggttcctgaacaggcaaaacagctgggtatcgactatgtcgccttgtgccggatg
attgttgaggaagccttggcggaagacacattacaagaaaccaaaatggcaggacagggt
ggctaa

DBGET integrated database retrieval system