Zymomonas mobilis subsp. mobilis ZM4: ZMO1279 Help Entry ZMO1279           CDS       T00221                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism zmo  Zymomonas mobilis subsp. mobilis ZM4 Pathway zmo01100   Metabolic pathways zmo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:zmo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ZMO1279   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ZMO1279 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AAV89903 UniProt:  Q5NN07 LinkDB All DBs Position complement(1294364..1294600) Genome browser AA seq 78 aa AA seqDB search MSDTAERIKKIVVEHLGVEPDKVVENASFLDDLGADSLDIIELVMAFEEEFGVEIPDDSV EKIGTVKDAVSYIDEHKA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatactgcagagcgcatcaagaagattgttgtcgaacatctcggcgttgaaccc gacaaagttgtcgaaaatgccagcttccttgacgatctgggtgccgacagcctcgacatc atcgaattggttatggctttcgaagaagaattcggcgttgaaattcctgacgattccgta gaaaaaatcggtacggtcaaagatgccgtcagctatatcgacgagcacaaggcttaa

DBGET integrated database retrieval system