KEGG   Zygosaccharomyces rouxii: ZYRO0E09878gHelp
Entry
ZYRO0E09878g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZYRO0E09878g
   00051 Fructose and mannose metabolism
    ZYRO0E09878g
   00052 Galactose metabolism
    ZYRO0E09878g
   00500 Starch and sucrose metabolism
    ZYRO0E09878g
   00520 Amino sugar and nucleotide sugar metabolism
    ZYRO0E09878g
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ZYRO0E09878g
Enzymes [BR:zro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     ZYRO0E09878g
Membrane trafficking [BR:zro04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    ZYRO0E09878g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
E:complement(784297..785757)
Genome map
AA seq 486 aa AA seqDB search
MVHLGPKKPPARKGSMADMPQDLLDQVRGLEVIFSVSTEKLRAVTKHFIDELQKGLSKKG
GNIPMIPGWVLEYPTGKETGNYLAIDLGGTNLRVVLVKLNGDRTFDSSQSKYKLPHHMRT
TRNPKDLFDFIASSLKNFIEEEFPNGCEDTLPLGFTFSYPASQGKINEGVLQRWTKGFDI
PGVEGHDVVPMLQESLSEKGVPINVVALINDTTGTLVASHYTDPETQMGVIFGTGVNGAY
YDVCKDIEKLQGQLPEDITPDTLMGINCEYGSFDNEHVVLPRTKYDVIVDEESPRPGQQS
FEKMSSGYYLGEIIRLVLIDLHEQGFIFKDQDVSKLREPYVMDTSYPSMIEEDPFENLED
TFDLFQKDLGITTTTPERKLIRRLCELIGTRAARLSVCGIAAICQKRGYKTAHIAADGSV
FNKYPGFKERAAAALNDIYGWGIEDRHKQPIQIVAAEDGSGAGAAIIAALTQQRLAANKS
VGVIGK
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggttcatttaggtccaaaaaaaccacccgcaagaaagggttctatggctgacatgcca
caagaccttttagatcaagttcgtggtctagaagttatcttctcagtctcaactgaaaaa
ttgagagctgttacaaagcatttcattgatgaactacaaaaaggtttgtccaagaagggt
ggtaacatcccaatgattccaggatgggtcctagaatacccaactggtaaggaaaccggt
aactacttggctatcgatttgggtggtaccaacctaagagttgttttggttaagttaaat
ggtgaccgtacttttgattcttctcaatccaagtacaaattgcctcaccacatgagaacc
actagaaaccctaaggatctattcgacttcatcgcttcaagtttgaagaactttatcgaa
gaagagttcccaaatggatgtgaagacactcttccattgggtttcaccttttcttaccca
gcatcccaaggtaagattaacgaaggtgttctacagagatggactaagggtttcgatatt
ccaggtgtggaaggtcatgatgtcgtgcctatgttgcaagagtctctaagtgaaaagggt
gtgccaattaatgttgttgccttgattaacgatactaccggtactctagttgcatctcac
tatactgacccagagactcagatgggtgttatcttcggtactggtgttaacggtgcttac
tacgatgtctgtaaggacattgaaaaattgcaaggccaattgcctgaagatatcactcct
gacaccctaatgggtatcaactgtgaatacggttcattcgataacgaacatgtggttttg
ccaagaaccaaatacgatgtcatcgtcgatgaagaatccccaagacctggtcaacaatct
tttgaaaagatgtcatcaggttactacttgggtgaaatcatccgtttagttttgattgac
ttacatgaacagggtttcatcttcaaggaccaagatgttagcaagttgagagaaccttac
gtcatggatacttcttacccatccatgattgaagaagatccatttgaaaacttggaagac
actttcgatcttttccaaaaggatttgggcatcactaccactactcctgaacgtaagttg
atcagacgtctatgtgagttgatcggtactagagccgccagattatctgtttgtggtatc
gcagctatctgtcaaaagagaggctacaagactgctcacattgctgctgatggttccgtc
ttcaacaagtaccctggtttcaaggaaagagctgcagctgctttgaacgacatctatgga
tggggtattgaagatcgtcacaagcaaccaatccagattgtcgccgccgaagatggttcc
ggtgctggtgcagcaatcatcgctgctttgactcagcagagacttgctgccaacaaatct
gttggtgtcattggcaaataa

DBGET integrated database retrieval system