KEGG   Zygosaccharomyces rouxii: ZYRO0F12826gHelp
Entry
ZYRO0F12826g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    ZYRO0F12826g
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ZYRO0F12826g
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ZYRO0F12826g
   00430 Taurine and hypotaurine metabolism
    ZYRO0F12826g
Enzymes [BR:zro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     ZYRO0F12826g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
F:1044595..1046367
Genome map
AA seq 590 aa AA seqDB search
MLYKHTRSQKQPRSLNQRSHPEKGLEDAALLPEHLSKVSLSNSSQDVDPTLHAPHIHYSV
PEHGVPEQKAYDLIHNELTLDGNPHLNLASFVNTESTDLAKKLINENVNKNLADNDEYPQ
LIELTQRCISMISQLWKVNENDEPIGCATTGSSEAIMLGGLAMKKRWEHRMRAAGKPIDK
PNIIMSSACQVALEKFARYFEVEAREVPVNAHSHHSLDPKNLWDFVDENTIGIFVILGTT
YTGHFESVDATAEVLSQIESQHPEWSNKEIPIHVDGASGGFVVPFAFSDKQMATINNGNW
GFNNPRVVSMNASGHKFGLTTPGLGWVLWKSEDYLAEELRFKLKYLGGVEETFGLNFSRP
GFQVVHQYFNLVSLGKQGYQDRFNKSLFVARTFCHALLHNETFPGAFEPVSSIHQRISDG
STPQHPQDYWNHPELYTPGVPLVAFKLTSAFHKKYPEIPQSVISGLLRARGWIIPNYPLP
KSTDGSDKQEVLRVVFRSEMSLDLALMLLQDIEAVLGKAIRSYKAIESSVDQMNSEGAKN
LIYKMLNSLTTPDSGEDDNDDADEGEKKQRREARLGNEHDHVHKNYRGTC
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgttgtacaagcacactagatcacaaaagcaaccaagaagccttaaccaaagaagtcat
cccgaaaagggcttggaagatgccgccctattgcctgaacatttgagcaaggttagtctt
tctaatagtagtcaagacgttgatccaacattacatgcacctcatattcattacagtgtt
cctgaacatggtgttcctgaacagaaggcttacgatttaatccacaacgaattgaccctt
gatggtaatccacatttaaacttggcaagttttgtaaatactgagtctacagatttggct
aaaaaattaatcaatgagaatgttaacaagaatttagccgataacgatgagtatccacag
ttaatcgaacttactcaaagatgtatttctatgatctcacagctatggaaggttaacgag
aatgatgagccaattggttgtgccactacgggttccagtgaagccattatgcttggtggt
cttgccatgaaaaaacgttgggaacatcgaatgcgcgctgctggtaagccaattgataag
cccaatattatcatgtcaagtgcatgtcaagttgctctcgaaaaatttgcacgttacttc
gaagttgaagcccgtgaggttccagttaatgcacattctcaccattctttggatccaaaa
aatctatgggattttgtagatgaaaatactattggtatctttgtcatcctgggtaccact
tacacaggtcattttgaaagtgtggatgcaacagctgaggttctttcccaaattgaatct
cagcatccagaatggtccaacaaggagatccctatccatgtcgatggtgcttctggtgga
tttgtcgtcccatttgccttttctgataaacaaatggccactattaacaatggtaattgg
ggttttaacaatccaagagtcgtcagtatgaatgcatctggtcacaagttcggattgacc
acaccaggtctaggttgggttctatggaagagcgaagattatttagccgaggaactaaga
ttcaaactgaaatatctcggtggtgtagaagagacctttggtctcaatttctcaagacct
ggtttccaagtggttcaccagtacttcaacctcgtttcactcggtaagcagggctaccag
gatcgctttaacaaatcattattcgttgcacgtacgttctgccatgccttactacacaac
gaaactttcccaggagcttttgaaccggttagtagtattcaccagcgtattagtgatggt
tccaccccacaacatccacaagactactggaaccaccctgagctttacacgcctggtgtt
ccactggtcgctttcaagttaacttcagcattccataaaaagtatccagagataccccag
agcgtaatttcaggtctcttgagagcaagaggctggattatccccaactacccactacca
aaatcaacggatggtagtgacaagcaagaagtgttaagggtcgtgttcagatccgaaatg
agtctagacttggctttgatgttgcttcaggacattgaagctgtcctgggtaaagctatc
agatcctacaaggctattgagtcaagtgtcgaccaaatgaactcagaaggtgccaagaac
cttatttacaagatgctgaacagcttgactaccccagatagtggtgaggacgataatgac
gacgctgacgaaggggaaaagaagcagagacgggaagcaagacttggcaacgagcacgac
cacgtgcacaagaactacagaggtacctgttaa

DBGET integrated database retrieval system