KEGG   Zymoseptoria tritici: MYCGRDRAFT_111327Help
Entry
MYCGRDRAFT_111327 CDS       T02285                                 

Definition
(RefSeq) hypothetical protein
  KO
K14790  
nucleolar protein 9
Organism
ztr  Zymoseptoria tritici
Brite
Ribosome biogenesis [BR:ztr03009]
 Eukaryotic Type
  90S particles
   Other 90S particles
    MYCGRDRAFT_111327
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
11
AA seq 1221 aa AA seqDB search
MPKEGLKRGRRMKRKHEDVLEDVTHPDASSKRIKEAEPEFMPLNGTDHDENMDAAYPPAE
ERVFFGMLDDDEQEYFKRADEMLELDQFSDPDERKLFLESVYREADGKELKIAHSQSCSR
LMERLIRVSNASQLKNLFQKFSGNFIHMLSHRFASHCCETLFTYAAPLVSEELTTKKKDI
KQTDVNDVYVSLENLFLHTLAELEGNLGFLLTDKYASHALRVLLLVLSGSPATNDSAKSI
LHSKRREGAPIAGTTKSTEQATDNKRPVPKAFSTALEKLIHDSVAGLDTDKLRALATHPS
ANPTLQLLLTLELTHYGKQRAKDSKSIIRTLLPDDPFTSDCESAGFISGLVYDPVGAHLV
ERIIENAPAKLFKSLYNQFFKERLASHAKNETATYVVCRILGRLGYDDLLEAHEILLPII
PTLLERQWTSLTKTLIERCTVRDIDTQAIAAVFEQTFQKDDQFDVEQLLKLEVQKPDTVR
DINKVNAHANGDDAFFARPSGPNKVHFNILAQSMLIVPGSLSALILDSMTTLEAATLLSM
ASDHVVTRTLQQAFTTKNASMIQRRKLIQRFYGNFGEMALDKSASHVVDCIWEGTHGLAF
IRERIAEELAENEAMLRDSPCGRAVWKNWKMDMYKRKRPDWVRQSRLKASNEGFQAFSEI
DAKESKTPLQIARERHAQAKAKREKEEAGRGRTMARNGEGKKEVKSKATGANRTRPLLSA
VQALIKPFIQSADTDTPQKVHGIDPRPNGSKPPLSNSLPPQDLKQLLPSSLPQDGVGKDD
FLSIVQTILTNSTNTWDTGFLDKLYSTPTPIGLASDLLLSTLNTNLHVYQVSPALTLIEK
LTCRSLATLFGFIGPYAGGVSQPGGSAANATSMVTARNILFPETKMEGNGGRKFVLFTSE
HGHYSVEKAAQMFGFGSRAVKSVAVDSSGRMDPKALSSAIATSRQAGETPFYVNATAGTT
VLGSFDPLVAIADVCQKEGLWLHVDGSWGGSVIFSEAQRHKLQGSSRADSICICAHKMLQ
VPLTCSFLLVSDMRRLHQGMTLPAGYLFHSADPPEEMTNGHHHAEKEEREWDGIPGSLDQ
FYDLADLTPQCGRRGDSLKLALTWLYHGSSGFSAAIDHAFSIATHLTSLIASNPKFTLVS
SDPPACLQVCFYYAKTSDAGRNSAVTEGITKVLREEGGFMTDFAPGEHGKFFRVVVNGGT
DRGTVEGLVKGIERAGERMGL
NT seq 3666 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaagagggcctcaagcgtggaaggcgcatgaagcgcaaacatgaagatgtcctc
gaagatgtgacccacccggatgccagctcaaaacgtataaaggaagccgagcccgagttc
atgcctctgaatgggactgaccacgacgaaaacatggacgccgcatacccccccgccgag
gagcgagtctttttcggcatgctcgacgacgacgagcaggagtacttcaaacgtgcggac
gaaatgttggagctggatcaattctcggaccctgacgaacggaaacttttcctggagagt
gtctaccgcgaagctgatggcaaggaactcaagatcgcccacagtcaatcctgttcacga
ttgatggagagattgattcgcgtgtccaacgcatctcaactcaagaatctgttccaaaaa
ttcagcggaaacttcattcacatgctctcgcaccgctttgcctcgcattgctgcgaaacg
ctattcacctacgcggctccactcgtcagcgaagagctcaccacgaagaagaaggacatc
aaacagactgatgtcaatgatgtctacgtttcattggagaatttgtttcttcacactctg
gccgaattagaagggaatctgggcttcctcttgactgacaaatatgcctcacacgctctc
cgagtcctcttgttggtactgtcgggatcgcccgcgacgaacgattccgccaaaagcatc
cttcacagcaagcggagagaaggtgcaccaattgctggaaccacgaaatcgaccgaacaa
gctaccgacaacaagcggcctgtgccgaaagcattctcgacagcgttggagaagctcatt
cacgacagtgttgctggccttgacacggacaagctccgagctttggctacccacccatcc
gcgaatccgactcttcaactcctcctcaccctagaactcacacactacggcaagcagcga
gcgaaggacagcaaatcgatcatccgaaccctcctacccgacgatcctttcacatccgac
tgcgagagtgccgggttcatcagtggtctggtgtatgatccagtgggagcacatttggtg
gagaggattattgaaaacgcaccggcgaaactattcaagagcttgtataaccaattcttc
aaggagagattagcctctcatgcgaagaatgagactgcgacatatgtggtttgccgcatc
ctgggacgactcggatacgatgacctactggaagctcacgagattttgcttccaatcata
cccactctgctggagaggcaatggacaagtttgaccaagacgttgatcgagagatgcaca
gttcgggacatcgacacacaagcaatcgcagcagtcttcgaacagactttccaaaaggac
gatcaattcgacgtggaacagctcctcaaattggaagtgcagaaaccggacacagtgcgc
gacatcaacaaagtcaatgcacatgccaacggagacgacgcctttttcgcgcggccatca
ggacccaacaaagtccacttcaacatcctcgctcagtccatgctcatcgtaccaggctcc
ctctcagctctcattctcgactcgatgaccacactcgaagccgcgaccctcctcagcatg
gcttccgaccatgtagtcacccgcacactgcaacaagccttcaccacgaagaacgcctcg
atgatccaacgccgcaaactcattcagcgcttctacggaaacttcggcgagatggctttg
gataagtccgcctctcacgtggtggattgcatctgggaaggcactcacggtctagcgttc
atcagagaacgcatcgcagaagagctagctgaaaacgaggcgatgttgagagatagcccg
tgtggcagagcagtatggaagaactggaaaatggacatgtacaaacggaaacgaccggac
tgggtcaggcagagcagattgaaggcgagcaacgaggggttccaggcattctcggagatc
gatgcaaaggaaagcaagacgccgctgcagatagcgagggagagacatgcgcaggcgaag
gcgaagcgggagaaagaggaagctggcagagggaggacgatggcgaggaatggggaaggc
aagaaggaggtcaagtcgaaagctactggggcgaaccggacgaggccgctcctctcagcc
gtccaagccctcataaaacccttcatccaatccgccgacaccgacactccccaaaaagta
cacggcatcgatccccgacccaatggctccaaaccccctctctccaactccctacctcct
caagacctcaaacaacttctcccctcaagcttgccacaagacggcgttggcaaagacgac
ttcctatccatagtccagacgatcctaactaacagcaccaacacctgggacaccggcttc
ctcgacaaactctactccacgcccactcccatcggcctggcatccgacctcctcctctca
accctcaacacaaatctccacgtctaccaagtcagtccagcactcactctcatcgaaaaa
ctcacgtgtcggagtctcgccacgctcttcggtttcatagggccatatgccggaggtgta
tcgcaacccggtggttctgccgcgaatgcaacttcaatggtgaccgcgaggaatatcctc
tttccggagacgaaaatggaagggaatggcggaaggaaattcgtgttattcacgagtgag
cacgggcattacagcgtcgagaaggcggcgcagatgttcggcttcgggtccagggctgtc
aagtctgtcgctgtagactcgtccggaaggatggatcccaaggccctcagctcagcgatc
gcgacctcacgacaggcgggcgagacacccttttacgtcaacgctacagcaggaacgacc
gtcctcggctccttcgacccgctggtcgccatcgcggacgtctgccagaaagaaggacta
tggctgcacgtggacggctcctggggcggatcggtcatcttcagtgaagcgcaacggcat
aaactccagggttcctcacgcgcagactcgatttgcatctgcgcgcacaaaatgctgcaa
gtcccactaacctgctccttcctcctcgtctccgacatgaggcgcctacaccagggtatg
acgctccccgccggctacttattccactctgccgatccacctgaagagatgaccaatggc
caccaccacgctgagaaggaagaacgggaatgggacggcatccccggctcactggatcaa
ttctacgacctcgccgatttaacaccccaatgcggccgccggggcgacagtctcaaactc
gcccttacctggctgtatcacggctcctccggcttcagcgctgcgatcgaccacgctttc
tccatcgctactcacctcacctctctcatcgcttctaatcccaagttcaccctcgtctcc
tcggatccaccggcatgtttgcaagtctgcttttactacgcgaagacgtcggatgctggg
aggaacagtgccgtcacagaggggattacgaaagtactgagggaggaagggggtttcatg
acggatttcgcgccgggggagcatgggaagtttttcagggttgtggttaatggagggacg
gatagggggactgtggaggggttggtcaaggggattgagagggcgggggagaggatgggg
ttgtga

DBGET integrated database retrieval system