Zootoca vivipara (common lizard): 118088586 Help Entry 118088586         CDS       T07275                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism zvi  Zootoca vivipara (common lizard) Pathway zvi04010   MAPK signaling pathway zvi04012   ErbB signaling pathway zvi04068   FoxO signaling pathway zvi04137   Mitophagy - animal zvi04140   Autophagy - animal zvi04144   Endocytosis zvi04150   mTOR signaling pathway zvi04210   Apoptosis zvi04218   Cellular senescence zvi04370   VEGF signaling pathway zvi04371   Apelin signaling pathway zvi04510   Focal adhesion zvi04540   Gap junction zvi04625   C-type lectin receptor signaling pathway zvi04810   Regulation of actin cytoskeleton zvi04910   Insulin signaling pathway zvi04912   GnRH signaling pathway zvi04916   Melanogenesis zvi05132   Salmonella infection Brite KEGG Orthology (KO) [BR:zvi00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118088586 (HRAS)    04012 ErbB signaling pathway     118088586 (HRAS)    04370 VEGF signaling pathway     118088586 (HRAS)    04371 Apelin signaling pathway     118088586 (HRAS)    04068 FoxO signaling pathway     118088586 (HRAS)    04150 mTOR signaling pathway     118088586 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     118088586 (HRAS)    04140 Autophagy - animal     118088586 (HRAS)    04137 Mitophagy - animal     118088586 (HRAS)   09143 Cell growth and death    04210 Apoptosis     118088586 (HRAS)    04218 Cellular senescence     118088586 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     118088586 (HRAS)    04540 Gap junction     118088586 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     118088586 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     118088586 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     118088586 (HRAS)    04912 GnRH signaling pathway     118088586 (HRAS)    04916 Melanogenesis     118088586 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118088586 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:zvi04131]     118088586 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:zvi04147]     118088586 (HRAS)    04031 GTP-binding proteins [BR:zvi04031]     118088586 (HRAS) Membrane trafficking [BR:zvi04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     118088586 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     118088586 (HRAS) Exosome [BR:zvi04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    118088586 (HRAS)   Exosomal proteins of colorectal cancer cells    118088586 (HRAS) GTP-binding proteins [BR:zvi04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     118088586 (HRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N AAA_16 CbiA Motif Other DBs NCBI-GeneID:  118088586 NCBI-ProteinID:  XP_034978305 LinkDB All DBs Position LG1:74958946..75002666 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtggtagttggggcaggaggcgtagggaaaagtgctttgacc attcagcttattcagaaccattttgttgatgaatatgatccaacgatagaggattcctac agaaagcaggtcgtcattgatggagagacctgtttgttagacatcttggacacagcaggc caagaagagtacagtgccatgcgagaccagtacatgcggacaggagaaggcttcctttgt gtctttgctattaacaacaccaagtcctttgaagacattcatcagtacagggagcagatc aagagggtgaaggactctgatgatgtcccaatggtattggtggggaataagtgtgacctt ccagcccggactgtggaaacccggcaagcccaggagctggctcggagctatgggattccc tacatagagacatcggccaagactagacagggagttgaagatgccttctatactttagtg cgggagatccggcagcacaaactacgcaaattgaatcccccagatgaaagtggcccaggc tgcatgaattgtaaatgtgtgatatcatga

DBGET integrated database retrieval system