Accipiter gentilis (Northern goshawk): 126036699 Help Entry 126036699         CDS       T08649                                  Name (RefSeq) protein UXT   KO K26537   protein UXT Organism agen  Accipiter gentilis (Northern goshawk) Brite KEGG Orthology (KO) [BR:agen00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:agen03036]     126036699    03029 Mitochondrial biogenesis [BR:agen03029]     126036699 Chromosome and associated proteins [BR:agen03036]  Eukaryotic type   Histone modification proteins    Other histone modification proteins     126036699 Mitochondrial biogenesis [BR:agen03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Other regulator of mitochondrial biogenesis     126036699 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Prefoldin DUF1525 Motif Other DBs NCBI-GeneID:  126036699 NCBI-ProteinID:  XP_049652682 LinkDB All DBs Position Unknown AA seq 75 aa AA seqDB search RPSPQRVFVALGYGFFAELTLPEALRHLDRRSRLLDRLSESLTRDGAKIRAHIRLVLEGL RELQGLQDPPTTSDP NT seq 228 nt NT seq  +upstreamnt  +downstreamnt agaccatccccccagcgagttttcgtggctctgggctacgggttctttgcggagctgacg ttgcccgaggccctgcgtcacctcgatcgtcgcagccgcctcctcgaccggctcagcgaa tccctgacgcgggacggggccaagatccgggcgcacatcaggctggtgctggagggtcta cgggagctccaaggtctccaggaccctccaacgacctctgacccctga

DBGET integrated database retrieval system