Aphis gossypii (cotton aphid): 114131991 Help Entry 114131991         CDS       T05869                                  Name (RefSeq) elongin-C-like   KO K03872   elongin-C Organism ags  Aphis gossypii (cotton aphid) Pathway ags04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ags00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     114131991  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ags04121]     114131991    03400 DNA repair and recombination proteins [BR:ags03400]     114131991 Ubiquitin system [BR:ags04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      114131991    Cul5 complex      114131991 DNA repair and recombination proteins [BR:ags03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      114131991 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ ARL6IP6 Motif Other DBs NCBI-GeneID:  114131991 NCBI-ProteinID:  XP_027853155 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search MYIKLISSDEHEFIVKREHAMISSTITAMLTGPGQFLENQINEIRFRDIPSHILYVVCMY FAYKARYLNTTTEPPVFPISPLIARELLMAANFLDC NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgtatatcaagctaatatcgagtgacgagcacgagtttattgtcaagcgagagcatgca atgatatcaagcacaataacagctatgttaactggtccaggccagtttttagaaaatcaa ataaatgaaatccgtttcagagatataccttctcatattttatatgtggtatgtatgtac ttcgcatataaagctcgttaccttaacaccacaactgagcctcccgtgttccctatttca ccactaattgcacgtgaacttctgatggcagctaactttttggattgttaa

DBGET integrated database retrieval system