Astyanax mexicanus (Mexican tetra): 103028544 Help Entry 103028544         CDS       T05042                                  Name (RefSeq) insulin-like   KO K04526   insulin Organism amex  Astyanax mexicanus (Mexican tetra) Pathway amex04010   MAPK signaling pathway amex04068   FoxO signaling pathway amex04114   Oocyte meiosis amex04140   Autophagy - animal amex04150   mTOR signaling pathway amex04810   Regulation of actin cytoskeleton amex04910   Insulin signaling pathway amex04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:amex00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103028544    04068 FoxO signaling pathway     103028544    04150 mTOR signaling pathway     103028544  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103028544   09143 Cell growth and death    04114 Oocyte meiosis     103028544   09142 Cell motility    04810 Regulation of actin cytoskeleton     103028544  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     103028544    04914 Progesterone-mediated oocyte maturation     103028544  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:amex04052]     103028544 Cytokines and neuropeptides [BR:amex04052]  Neuropeptides   Neuropeptides (Unclassified)    103028544 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  103028544 NCBI-ProteinID:  XP_007247543 UniProt:  A0A8B9RHS3 LinkDB All DBs Position 24:8228437..8229315 Genome browser AA seq 108 aa AA seqDB search MALMLQAAPVLLLLVYSPGTHSAPSQYLCGSSLVDALYFVCGARGFFYANRGERDLEALL AVLSQTSPHENAVEGSPLKKAELKVKRGIVDQCCHRPCSFSHLQNYCN NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggccttgatgctgcaggcagccccagtgctcctcctgctggtctattcaccaggtacc cactccgctccatctcagtacctgtgtggctccagcctggtagatgctctctacttcgtt tgtggagcgagaggcttcttttatgccaacagaggagagagggacctcgaggccttgctg gctgtcctttcgcagacttccccacatgagaatgcagtggagggaagtcctctaaagaag gcggagctgaaggtaaagagaggaattgtggaccagtgttgccacagaccctgtagcttt tctcatctgcagaactactgcaactga

DBGET integrated database retrieval system