Astyanax mexicanus (Mexican tetra): 103040103 Help Entry 103040103         CDS       T05042                                  Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism amex  Astyanax mexicanus (Mexican tetra) Pathway amex04010   MAPK signaling pathway amex04012   ErbB signaling pathway amex04068   FoxO signaling pathway amex04137   Mitophagy - animal amex04140   Autophagy - animal amex04144   Endocytosis amex04150   mTOR signaling pathway amex04210   Apoptosis amex04218   Cellular senescence amex04370   VEGF signaling pathway amex04371   Apelin signaling pathway amex04510   Focal adhesion amex04540   Gap junction amex04625   C-type lectin receptor signaling pathway amex04810   Regulation of actin cytoskeleton amex04910   Insulin signaling pathway amex04912   GnRH signaling pathway amex04916   Melanogenesis amex05132   Salmonella infection Brite KEGG Orthology (KO) [BR:amex00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103040103    04012 ErbB signaling pathway     103040103    04370 VEGF signaling pathway     103040103    04371 Apelin signaling pathway     103040103    04068 FoxO signaling pathway     103040103    04150 mTOR signaling pathway     103040103  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103040103    04140 Autophagy - animal     103040103    04137 Mitophagy - animal     103040103   09143 Cell growth and death    04210 Apoptosis     103040103    04218 Cellular senescence     103040103   09144 Cellular community - eukaryotes    04510 Focal adhesion     103040103    04540 Gap junction     103040103   09142 Cell motility    04810 Regulation of actin cytoskeleton     103040103  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103040103   09152 Endocrine system    04910 Insulin signaling pathway     103040103    04912 GnRH signaling pathway     103040103    04916 Melanogenesis     103040103  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103040103  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:amex04131]     103040103   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:amex04147]     103040103    04031 GTP-binding proteins [BR:amex04031]     103040103 Membrane trafficking [BR:amex04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     103040103  Endocytosis   Macropinocytosis    Ras GTPases     103040103 Exosome [BR:amex04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    103040103   Exosomal proteins of colorectal cancer cells    103040103 GTP-binding proteins [BR:amex04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     103040103 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  103040103 NCBI-ProteinID:  XP_022520986 Ensembl:  ENSAMXG00000000368 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDDNGQD CMNCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagttggtggtggttggagctggaggtgtgggtaaaagcgcactgacc attcagctgatccaaaaccacttcgttgacgagtacgaccctaccattgaggactcgtac aggaagcaggtggtgatcgatggagagacgtgtttgttggatattctggacacggcgggt caggaggagtacagcgctatgagggatcagtatatgaggacaggagagggattcctctgt gttttcgctattaacaacaccaagtcctttgaagatattcaccagtacagggaacagatt aagagagtgaaggactctgatgatgtgcccatggtgctcgtgggtaataaatgtgatctc ccggcgcgtacggtcgacaccaggcaagcccaggaactggctcgcagctacggcatccct tacatcgagacgtccgccaagaccagacagggagtggaggatgcgttctacacgctggtg cgtgaaatcaggcagcacaaactgaggaagctgaacccgccggacgataacggacaggac tgcatgaactgtcgctgtgtggtgtcctga

DBGET integrated database retrieval system