Ailuropoda melanoleuca (giant panda): 100476556 Help Entry 100476556         CDS       T01329                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04060   Cytokine-cytokine receptor interaction aml04151   PI3K-Akt signaling pathway aml04217   Necroptosis aml04380   Osteoclast differentiation aml04620   Toll-like receptor signaling pathway aml04621   NOD-like receptor signaling pathway aml04622   RIG-I-like receptor signaling pathway aml04623   Cytosolic DNA-sensing pathway aml04630   JAK-STAT signaling pathway aml04650   Natural killer cell mediated cytotoxicity aml04668   TNF signaling pathway aml04936   Alcoholic liver disease aml05135   Yersinia infection aml05142   Chagas disease aml05152   Tuberculosis aml05160   Hepatitis C aml05161   Hepatitis B aml05162   Measles aml05163   Human cytomegalovirus infection aml05164   Influenza A aml05165   Human papillomavirus infection aml05167   Kaposi sarcoma-associated herpesvirus infection aml05168   Herpes simplex virus 1 infection aml05169   Epstein-Barr virus infection aml05170   Human immunodeficiency virus 1 infection aml05171   Coronavirus disease - COVID-19 aml05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100476556 (IFNB1)    04668 TNF signaling pathway     100476556 (IFNB1)    04151 PI3K-Akt signaling pathway     100476556 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100476556 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100476556 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100476556 (IFNB1)    04621 NOD-like receptor signaling pathway     100476556 (IFNB1)    04622 RIG-I-like receptor signaling pathway     100476556 (IFNB1)    04623 Cytosolic DNA-sensing pathway     100476556 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     100476556 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     100476556 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100476556 (IFNB1)    05161 Hepatitis B     100476556 (IFNB1)    05160 Hepatitis C     100476556 (IFNB1)    05171 Coronavirus disease - COVID-19     100476556 (IFNB1)    05164 Influenza A     100476556 (IFNB1)    05162 Measles     100476556 (IFNB1)    05168 Herpes simplex virus 1 infection     100476556 (IFNB1)    05163 Human cytomegalovirus infection     100476556 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     100476556 (IFNB1)    05169 Epstein-Barr virus infection     100476556 (IFNB1)    05165 Human papillomavirus infection     100476556 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     100476556 (IFNB1)    05152 Tuberculosis     100476556 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     100476556 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100476556 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100476556 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aml04052]     100476556 (IFNB1) Cytokines and neuropeptides [BR:aml04052]  Cytokines   Interferons    100476556 (IFNB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Tic22 Motif Other DBs NCBI-GeneID:  100476556 NCBI-ProteinID:  XP_002918575 Ensembl:  ENSAMEG00000020237 UniProt:  D2H9N6 LinkDB All DBs Position 7:complement(13701133..13701693) Genome browser AA seq 186 aa AA seqDB search MTSRCILQTALLVYFSTTVLAVNYDLLRFQLSSSSVECQNLLLQLNGTTKDCIKDRMNFK FPEEIEKPQQVQKEALLLVTLDIFQKTSDIFRKNLSSTGWNEIIVNNLLEKIHWQIEHLE EILEKIKEEENFTWDDRTLLPLKRYYLRIVRYLKAKVYSICAWKIVRAEMLRSFFFLDKF TNYLPN NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgaccagcaggtgcatcctccaaaccgctctcctggtgtacttctccaccacagttctc gccgtgaactacgacttgcttcgattccaactaagcagcagcagtgtggagtgccagaac ctccttctgcagttgaatggaactactaaagattgcatcaaggaccggatgaacttcaag ttccctgaggagatcgagaaaccccagcaggtccagaaggaggccctcctattggtcacc cttgacatattccagaagacctccgatattttcaggaaaaatctctcgagcacagggtgg aatgagatcattgtcaacaacctccttgagaaaatccattggcagatagaacatctggag gaaatcctggagaaaatcaaggaggaggaaaacttcacctgggacgacaggacccttctg cccctgaagagatattatctaaggattgtgcggtacctgaaggccaaggtgtacagcatt tgtgcctggaaaatagtgcgagcagaaatgctcaggagctttttcttccttgataaattt acgaattatctcccaaactga

DBGET integrated database retrieval system