Aminobacter niigataensis: AMD1_0185 Help Entry AMD1_0185         CDS       T09606                                  Name (GenBank) protein of unknown function   KO K09022   2-iminobutanoate/2-iminopropanoate deaminase [EC:3.5.99.10] Organism anj  Aminobacter niigataensis Brite KEGG Orthology (KO) [BR:anj00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     AMD1_0185 Enzymes [BR:anj01000]  3. Hydrolases   3.5  Acting on carbon-nitrogen bonds, other than peptide bonds    3.5.99  In other compounds     3.5.99.10  2-iminobutanoate/2-iminopropanoate deaminase      AMD1_0185 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribonuc_L-PSP Motif Other DBs NCBI-ProteinID:  CAI2931473 LinkDB All DBs Position AMD1:complement(178654..178917) Genome browser AA seq 87 aa AA seqDB search MRWRRGRDSISRRNPQMRYVLKNAAAICEAAGTSLENVVRRACFHDRGNSFAEGMDEWAV HFPGLKPVSTTIIVGLTSYPARTPSWT NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgcgctggcggagagggcgggattcgataagccgcagaaacccgcagatgcgctacgtg ctgaagaacgcggctgcgatctgcgaggccgccggcacgtcgctcgaaaatgtcgtgcgc cgcgcctgcttccacgatcgcggcaacagcttcgccgaggggatggacgaatgggcggtg catttccccggcctgaagccggtgtccaccaccattatcgtgggcctcacgtcgtacccg gcgcgcacgccctcctggacctga

DBGET integrated database retrieval system