Anolis sagrei ordinatus (Brown anole): 132763896 Help Entry 132763896         CDS       T09595                                  Name (RefSeq) C-C motif chemokine 4-like   KO K12964   C-C motif chemokine 4 Organism asao  Anolis sagrei ordinatus (Brown anole) Pathway asao04060   Cytokine-cytokine receptor interaction asao04620   Toll-like receptor signaling pathway asao04623   Cytosolic DNA-sensing pathway Brite KEGG Orthology (KO) [BR:asao00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     132763896  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     132763896    04623 Cytosolic DNA-sensing pathway     132763896  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:asao04052]     132763896 Cytokines and neuropeptides [BR:asao04052]  Cytokines   Chemokines    132763896 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  132763896 NCBI-ProteinID:  XP_060613713 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MKSSSSSSSSVLAFSALVLLLVAFLGNPVASAPLGSDPPTSCCFTYTLRKIPRSHVVDYY ETNSRCSQPGIVFITRKGREVCSNPAERWVQEYVNELELNGEGR NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgaaatcctcctcctcctcctcctcttccgtcctggccttttctgccttggtcctgcta ttggttgcctttctgggcaatccagtcgcctctgccccactgggatcggacccaccgacg tcttgctgcttcacttacacgctgaggaagatcccacggagccacgtggttgactactac gagaccaacagccgctgctcgcagcctggcattgtgttcatcactcgcaaggggcgtgag gtctgctccaacccggctgagcgatgggtccaggagtacgtcaatgagctggagctgaat ggagaaggccgatga

DBGET integrated database retrieval system