Aegilops tauschii (wheat D): 109737146 Help Entry 109737146         CDS       T04345                                  Name (RefSeq) RING-box protein 1-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism ats  Aegilops tauschii (wheat D) Pathway ats03420   Nucleotide excision repair ats04120   Ubiquitin mediated proteolysis ats04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ats00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109737146    04120 Ubiquitin mediated proteolysis     109737146   09124 Replication and repair    03420 Nucleotide excision repair     109737146  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ats04121]     109737146    03400 DNA repair and recombination proteins [BR:ats03400]     109737146 Enzymes [BR:ats01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      109737146 Ubiquitin system [BR:ats04121]  Ubiquitin ligases (E3)   UBL E3 ligases    109737146   Multi subunit Ring-finger type E3    SCF complex     Ring finger protein      109737146    Cul2 complex      109737146    Cul3 complex      109737146    Cul4 complex      109737146    Cul7 complex      109737146    Cul8 complex      109737146    Cul9 complex      109737146 DNA repair and recombination proteins [BR:ats03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       109737146     TCR (transcription coupled repair) factors      Cul4-CSA complex       109737146 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  109737146 NCBI-ProteinID:  XP_020151948 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MSAMETDAPDAPPPAPAADAGAGSSSRKPGKRFEIKKWNAVALWAWDIVVDNCAICRNHI MDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgtcggccatggagacggacgcccccgacgcgccgccgccggcccccgccgccgacgcc ggcgccgggtcgtcgtcccgcaagccgggcaagcgcttcgagatcaagaagtggaacgcc gtcgcgctttgggcgtgggacatcgtggtggacaactgcgccatctgccgcaaccacatc atggatctatgcatcgagtgccaggccaaccaggccagcgccaccagcgaggagtgcacc gtcgcatggggtgtctgtaatcatgctttccacttccactgcatcagcaggtggctcaag actcgccaagtgtgcccactagacaacagcgaatgggagttccagaaatacggccactag

DBGET integrated database retrieval system