Bombus bifarius (two-form bumblebee): 117213874 Help Entry 117213874         CDS       T07537                                  Name (RefSeq) glutathione S-transferase-like   KO K04097   prostaglandin-H2 D-isomerase / glutathione transferase [EC:5.3.99.2 2.5.1.18] Organism bbif  Bombus bifarius (two-form bumblebee) Pathway bbif00480   Glutathione metabolism bbif00590   Arachidonic acid metabolism bbif00980   Metabolism of xenobiotics by cytochrome P450 bbif00982   Drug metabolism - cytochrome P450 bbif01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:bbif00001]  09100 Metabolism   09103 Lipid metabolism    00590 Arachidonic acid metabolism     117213874   09106 Metabolism of other amino acids    00480 Glutathione metabolism     117213874   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     117213874    00982 Drug metabolism - cytochrome P450     117213874 Enzymes [BR:bbif01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      117213874  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.99  Other intramolecular oxidoreductases     5.3.99.2  prostaglandin-D synthase      117213874 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_N_2 DUF5591 GST_C_2 GST_N_4 GST_N_3 Motif Other DBs NCBI-GeneID:  117213874 NCBI-ProteinID:  XP_033315458 UniProt:  A0A6P8N3Y4 LinkDB All DBs Position Unknown AA seq 130 aa AA seqDB search MLPVLEIDGKPVAQSNAVARYLAKKYDLMGRNEWDAMICDVLVDTLGDFKQETDVQEFIC LIEEVQNKCIQTFFQTTWADFVFAAALENFEYMFGASALDKYPALRALKKRIHRIPAISD WLIRRPFTNS NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgctgcctgtgctggagatagacgggaaaccggtagcgcagagtaacgctgtggcgcga tacttggcgaagaagtacgatctaatgggaaggaacgaatgggatgcgatgatatgcgac gtgctcgtcgatactcttggagatttcaagcaagagacagacgttcaagaattcatttgt ttaatagaggaggtacaaaataaatgtatacaaaccttttttcagacgacatgggcggac ttcgtgtttgcagcggcccttgaaaatttcgagtatatgtttggggcatcagctttggat aaatatccagctcttcgagcattgaagaaaaggattcatagaataccggccatttctgat tggctgattaggcgcccattcacaaacagctaa

DBGET integrated database retrieval system