Bison bison bison (American bison): 104987701 Help Entry 104987701         CDS       T08726                                  Name (RefSeq) histone H2B type 2-F   KO K11252   histone H2B Organism bbis  Bison bison bison (American bison) Pathway bbis04613   Neutrophil extracellular trap formation bbis05034   Alcoholism bbis05203   Viral carcinogenesis bbis05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bbis00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     104987701  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     104987701   09163 Immune disease    05322 Systemic lupus erythematosus     104987701   09165 Substance dependence    05034 Alcoholism     104987701  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bbis03036]     104987701   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbis04147]     104987701 Chromosome and associated proteins [BR:bbis03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104987701 Exosome [BR:bbis04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104987701 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF6246 Motif Other DBs NCBI-GeneID:  104987701 NCBI-ProteinID:  XP_010837047 UniProt:  A0A6P3HCJ3 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccggatccagcaaaatccgctcctgctccaaaaaaaggttctaaaaaggctgtcacg aaagtgcagaagaaggatggcaagaagcgcaagcgcagccgcaaggagagctattccgtc tacgtgtataaggtgctgaaacaggtacacccggacaccggcatctcgtccaaggccatg ggcatcatgaattcttttgtcaatgacattttcgagcgcattgccggcgaagcgtcgcgc ctggcgcattacaacaagcgctcgaccattacttcccgagagatccagacggcggtacgc ctgctgcttcccggcgagctggctaaacacgccgtgtccgagggcaccaaggcggtcacc aagtacaccagttcaaagtaa

DBGET integrated database retrieval system