Bison bison bison (American bison): 105004636 Help Entry 105004636         CDS       T08726                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism bbis  Bison bison bison (American bison) Pathway bbis04146   Peroxisome bbis04213   Longevity regulating pathway - multiple species bbis05012   Parkinson disease bbis05014   Amyotrophic lateral sclerosis bbis05016   Huntington disease bbis05020   Prion disease bbis05022   Pathways of neurodegeneration - multiple diseases bbis05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:bbis00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     105004636 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     105004636 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     105004636 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     105004636 (SOD1)    05014 Amyotrophic lateral sclerosis     105004636 (SOD1)    05016 Huntington disease     105004636 (SOD1)    05020 Prion disease     105004636 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     105004636 (SOD1) Enzymes [BR:bbis01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      105004636 (SOD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  105004636 NCBI-ProteinID:  XP_010860610 Ensembl:  ENSBBBG00000016855 UniProt:  A0A6P3JB48 LinkDB All DBs Position Unknown AA seq 152 aa AA seqDB search MATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAG PHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAVVDIVDSLISLSGEYSIIGRTMVVHE KPDDLGRGGNEESTKTGNAGSRLACGVIGIAK NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atggcgacgaaggccgtctgcgtgctgaagggcgacggcccggtgcaaggcaccatccac ttcgaggcaaagggagatacagtcgtggtaactggatccattacaggattgactgaaggt gatcatggattccacgtccatcagtttggagacaatacacaaggctgtaccagtgcaggt cctcactttaatcctctgtccaaaaaacacggtgggccaaaagatgaagagaggcatgtt ggagacctgggcaatgtgacagctgacaaaaacggtgttgccgtcgtggatattgtagat tctctgatttcactctcaggagaatattccatcattggccgcacgatggtggtccatgaa aaaccagatgacttgggcagaggtggaaatgaagaaagtacaaagactggaaacgctgga agtcgtttggcctgtggtgtaattggaattgccaagtaa

DBGET integrated database retrieval system