Bos indicus (zebu cattle): 109560940 Help Entry 109560940         CDS       T04792                                  Name (RefSeq) GTPase HRas-like   KO K02833   GTPase HRas Organism biu  Bos indicus (zebu cattle) Pathway biu01521   EGFR tyrosine kinase inhibitor resistance biu01522   Endocrine resistance biu04010   MAPK signaling pathway biu04012   ErbB signaling pathway biu04014   Ras signaling pathway biu04015   Rap1 signaling pathway biu04062   Chemokine signaling pathway biu04068   FoxO signaling pathway biu04071   Sphingolipid signaling pathway biu04072   Phospholipase D signaling pathway biu04137   Mitophagy - animal biu04140   Autophagy - animal biu04144   Endocytosis biu04150   mTOR signaling pathway biu04151   PI3K-Akt signaling pathway biu04210   Apoptosis biu04211   Longevity regulating pathway biu04213   Longevity regulating pathway - multiple species biu04218   Cellular senescence biu04360   Axon guidance biu04370   VEGF signaling pathway biu04371   Apelin signaling pathway biu04510   Focal adhesion biu04540   Gap junction biu04550   Signaling pathways regulating pluripotency of stem cells biu04625   C-type lectin receptor signaling pathway biu04630   JAK-STAT signaling pathway biu04650   Natural killer cell mediated cytotoxicity biu04660   T cell receptor signaling pathway biu04662   B cell receptor signaling pathway biu04664   Fc epsilon RI signaling pathway biu04714   Thermogenesis biu04720   Long-term potentiation biu04722   Neurotrophin signaling pathway biu04725   Cholinergic synapse biu04726   Serotonergic synapse biu04730   Long-term depression biu04810   Regulation of actin cytoskeleton biu04910   Insulin signaling pathway biu04912   GnRH signaling pathway biu04915   Estrogen signaling pathway biu04916   Melanogenesis biu04917   Prolactin signaling pathway biu04919   Thyroid hormone signaling pathway biu04921   Oxytocin signaling pathway biu04926   Relaxin signaling pathway biu04929   GnRH secretion biu04933   AGE-RAGE signaling pathway in diabetic complications biu04935   Growth hormone synthesis, secretion and action biu05010   Alzheimer disease biu05022   Pathways of neurodegeneration - multiple diseases biu05034   Alcoholism biu05132   Salmonella infection biu05160   Hepatitis C biu05161   Hepatitis B biu05163   Human cytomegalovirus infection biu05165   Human papillomavirus infection biu05166   Human T-cell leukemia virus 1 infection biu05167   Kaposi sarcoma-associated herpesvirus infection biu05170   Human immunodeficiency virus 1 infection biu05200   Pathways in cancer biu05203   Viral carcinogenesis biu05205   Proteoglycans in cancer biu05206   MicroRNAs in cancer biu05207   Chemical carcinogenesis - receptor activation biu05208   Chemical carcinogenesis - reactive oxygen species biu05210   Colorectal cancer biu05211   Renal cell carcinoma biu05213   Endometrial cancer biu05214   Glioma biu05215   Prostate cancer biu05216   Thyroid cancer biu05218   Melanoma biu05219   Bladder cancer biu05220   Chronic myeloid leukemia biu05221   Acute myeloid leukemia biu05223   Non-small cell lung cancer biu05224   Breast cancer biu05225   Hepatocellular carcinoma biu05226   Gastric cancer biu05230   Central carbon metabolism in cancer biu05231   Choline metabolism in cancer biu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer biu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109560940    04012 ErbB signaling pathway     109560940    04014 Ras signaling pathway     109560940    04015 Rap1 signaling pathway     109560940    04370 VEGF signaling pathway     109560940    04371 Apelin signaling pathway     109560940    04630 JAK-STAT signaling pathway     109560940    04068 FoxO signaling pathway     109560940    04072 Phospholipase D signaling pathway     109560940    04071 Sphingolipid signaling pathway     109560940    04151 PI3K-Akt signaling pathway     109560940    04150 mTOR signaling pathway     109560940  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     109560940    04140 Autophagy - animal     109560940    04137 Mitophagy - animal     109560940   09143 Cell growth and death    04210 Apoptosis     109560940    04218 Cellular senescence     109560940   09144 Cellular community - eukaryotes    04510 Focal adhesion     109560940    04540 Gap junction     109560940    04550 Signaling pathways regulating pluripotency of stem cells     109560940   09142 Cell motility    04810 Regulation of actin cytoskeleton     109560940  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109560940    04650 Natural killer cell mediated cytotoxicity     109560940    04660 T cell receptor signaling pathway     109560940    04662 B cell receptor signaling pathway     109560940    04664 Fc epsilon RI signaling pathway     109560940    04062 Chemokine signaling pathway     109560940   09152 Endocrine system    04910 Insulin signaling pathway     109560940    04929 GnRH secretion     109560940    04912 GnRH signaling pathway     109560940    04915 Estrogen signaling pathway     109560940    04917 Prolactin signaling pathway     109560940    04921 Oxytocin signaling pathway     109560940    04926 Relaxin signaling pathway     109560940    04935 Growth hormone synthesis, secretion and action     109560940    04919 Thyroid hormone signaling pathway     109560940    04916 Melanogenesis     109560940   09156 Nervous system    04725 Cholinergic synapse     109560940    04726 Serotonergic synapse     109560940    04720 Long-term potentiation     109560940    04730 Long-term depression     109560940    04722 Neurotrophin signaling pathway     109560940   09158 Development and regeneration    04360 Axon guidance     109560940   09149 Aging    04211 Longevity regulating pathway     109560940    04213 Longevity regulating pathway - multiple species     109560940   09159 Environmental adaptation    04714 Thermogenesis     109560940  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109560940    05206 MicroRNAs in cancer     109560940    05205 Proteoglycans in cancer     109560940    05207 Chemical carcinogenesis - receptor activation     109560940    05208 Chemical carcinogenesis - reactive oxygen species     109560940    05203 Viral carcinogenesis     109560940    05230 Central carbon metabolism in cancer     109560940    05231 Choline metabolism in cancer     109560940    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     109560940   09162 Cancer: specific types    05210 Colorectal cancer     109560940    05225 Hepatocellular carcinoma     109560940    05226 Gastric cancer     109560940    05214 Glioma     109560940    05216 Thyroid cancer     109560940    05221 Acute myeloid leukemia     109560940    05220 Chronic myeloid leukemia     109560940    05218 Melanoma     109560940    05211 Renal cell carcinoma     109560940    05219 Bladder cancer     109560940    05215 Prostate cancer     109560940    05213 Endometrial cancer     109560940    05224 Breast cancer     109560940    05223 Non-small cell lung cancer     109560940   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     109560940    05170 Human immunodeficiency virus 1 infection     109560940    05161 Hepatitis B     109560940    05160 Hepatitis C     109560940    05163 Human cytomegalovirus infection     109560940    05167 Kaposi sarcoma-associated herpesvirus infection     109560940    05165 Human papillomavirus infection     109560940   09171 Infectious disease: bacterial    05132 Salmonella infection     109560940   09164 Neurodegenerative disease    05010 Alzheimer disease     109560940    05022 Pathways of neurodegeneration - multiple diseases     109560940   09165 Substance dependence    05034 Alcoholism     109560940   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109560940   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     109560940   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     109560940    01522 Endocrine resistance     109560940  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:biu04131]     109560940   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:biu04147]     109560940    04031 GTP-binding proteins [BR:biu04031]     109560940 Membrane trafficking [BR:biu04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     109560940  Endocytosis   Macropinocytosis    Ras GTPases     109560940 Exosome [BR:biu04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    109560940   Exosomal proteins of colorectal cancer cells    109560940 GTP-binding proteins [BR:biu04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     109560940 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Motif Other DBs NCBI-GeneID:  109560940 NCBI-ProteinID:  XP_019818944 UniProt:  A0A6P5C034 LinkDB All DBs Position 7:13828500..13829519 Genome browser AA seq 164 aa AA seqDB search MRKSALTIQLIENHPVEDNSTMEEGWLSLSSYWKQVVTDGETYLLDTAGQESQRHGDQYM STSEGFPLGVCINNTESFKGIHQPWEQIKWVKDSDGIPVVLVGTSVTWSWYRRVSAGQNL TQNCSVPCRQLLDLWLQLRDPLEPTSIPLTQQPLKLAPQGPSQP NT seq 495 nt NT seq  +upstreamnt  +downstreamnt atgaggaagagtgccctgaccatccagctcatcgagaaccaccccgtggaggacaactcc accatggaggaaggttggctgtctctaagttcctactggaagcaagtggtcactgatggg gagacctacctactggacacagcaggccaggagagtcagcgtcatggagaccagtacatg agcaccagcgagggctttcctctgggtgtttgcatcaacaataccgagtccttcaagggc atccaccagccctgggagcagatcaagtgggtgaaggactcagatggcatacctgtggtg ctggtgggaacgagtgtgacctggtcatggtaccgtcgagtctcagcaggccagaacctc acccaaaactgcagcgtcccctgcaggcagctgctcgacctctggcttcagctaagggac cccctggaacccacttcgattcccctgacccagcagcccctcaagctagcgccccaaggt cccagtcagccctga

DBGET integrated database retrieval system