Bos indicus (zebu cattle): 109561151 Help Entry 109561151         CDS       T04792                                  Symbol CSTB Name (RefSeq) cystatin-B   KO K13907   cystatin-A/B Organism biu  Bos indicus (zebu cattle) Brite KEGG Orthology (KO) [BR:biu00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:biu01002]     109561151 (CSTB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:biu04147]     109561151 (CSTB) Peptidases and inhibitors [BR:biu01002]  Peptidase inhibitors   Family I25: cystatin family    109561151 (CSTB) Exosome [BR:biu04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    109561151 (CSTB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin Dynein_light Motif Other DBs NCBI-GeneID:  109561151 NCBI-ProteinID:  XP_019819112 UniProt:  A0A6P5C1J1 LinkDB All DBs Position 1:147672545..147676030 Genome browser AA seq 98 aa AA seqDB search MMCGGTSATQPATAETQAIADKVKSQLEEKENKKFPVFKALEFKSQLVAGKNYFIKVQVD EDDFVHIRVFESLPHENKPVALTSYQTNKGRHDELTYF NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgatgtgcggagggacttccgccacgcagccggccacagccgagacccaggccatcgcc gacaaggtcaagtcccagctggaggagaaggagaacaagaagttcccagtgttcaaggct ctggagttcaaaagccagttggttgctgggaagaactacttcatcaaggttcaagtggac gaggatgacttcgtgcacatccgagtgtttgaaagcctcccgcatgagaacaagcccgtg gccttgaccagctaccagaccaacaaaggcaggcatgacgagctgacctacttctag

DBGET integrated database retrieval system