Bos indicus (zebu cattle): 109574570 Help Entry 109574570         CDS       T04792                                  Name (RefSeq) C-C motif chemokine 4   KO K12964   C-C motif chemokine 4 Organism biu  Bos indicus (zebu cattle) Pathway biu04060   Cytokine-cytokine receptor interaction biu04061   Viral protein interaction with cytokine and cytokine receptor biu04062   Chemokine signaling pathway biu04064   NF-kappa B signaling pathway biu04620   Toll-like receptor signaling pathway biu04623   Cytosolic DNA-sensing pathway biu05163   Human cytomegalovirus infection Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     109574570   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109574570    04061 Viral protein interaction with cytokine and cytokine receptor     109574570  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109574570    04623 Cytosolic DNA-sensing pathway     109574570    04062 Chemokine signaling pathway     109574570  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     109574570  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:biu04052]     109574570 Cytokines and neuropeptides [BR:biu04052]  Cytokines   Chemokines    109574570 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  109574570 NCBI-ProteinID:  XP_019838184 UniProt:  A0A6P5DK91 LinkDB All DBs Position 19:complement(13801552..13803231) Genome browser AA seq 92 aa AA seqDB search MKLCVTVLSLLVLMAAFCSPALSAPMGSDPPTACCFSYTLRKIPRNFVNDYFETSSLCSQ PAVVFQTKKGRQVCANPSEPWVQEYVDDLELN NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaagctctgcgtgactgtcctgtccctcctcgtgctcatggctgccttctgttctcca gcgctctcagcaccaatgggctcagaccctcccacggcctgctgcttctcttacactctg cggaagattcctcgcaactttgtgaatgactacttcgagaccagcagcctctgctcccag ccagctgtggtattccagaccaaaaagggcaggcaggtctgcgccaaccccagtgagccc tgggtccaggagtacgtggatgaccttgaattgaactga

DBGET integrated database retrieval system