Bos indicus (zebu cattle): 109576146 Help Entry 109576146         CDS       T04792                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism biu  Bos indicus (zebu cattle) Pathway biu04137   Mitophagy - animal biu04140   Autophagy - animal biu04144   Endocytosis biu04145   Phagosome biu04148   Efferocytosis biu05132   Salmonella infection biu05146   Amoebiasis biu05152   Tuberculosis Brite KEGG Orthology (KO) [BR:biu00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     109576146 (RAB7A)    04145 Phagosome     109576146 (RAB7A)    04140 Autophagy - animal     109576146 (RAB7A)    04137 Mitophagy - animal     109576146 (RAB7A)    04148 Efferocytosis     109576146 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109576146 (RAB7A)    05152 Tuberculosis     109576146 (RAB7A)   09174 Infectious disease: parasitic    05146 Amoebiasis     109576146 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:biu04131]     109576146 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:biu04147]     109576146 (RAB7A)    04031 GTP-binding proteins [BR:biu04031]     109576146 (RAB7A) Membrane trafficking [BR:biu04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     109576146 (RAB7A) Exosome [BR:biu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109576146 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    109576146 (RAB7A)   Exosomal proteins of colorectal cancer cells    109576146 (RAB7A)   Exosomal proteins of bladder cancer cells    109576146 (RAB7A) GTP-binding proteins [BR:biu04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     109576146 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_7 NTPase_1 AAA_24 AAA_22 AAA_16 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 SRPRB ATP-synt_ab FLYWCH_N Motif Other DBs NCBI-GeneID:  109576146 NCBI-ProteinID:  XP_019840140 UniProt:  A0A6P5DSS2 LinkDB All DBs Position 22:complement(61040452..61085507) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRTKPSAEGCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctcgaggaagaaagtgctgctgaaggtgatcatcctgggagactctggagtcggg aagacctcactcatgaaccagtacgtgaacaagaagtttagtaaccagtacaaagccaca atcggggccgacttcctgacgaaggaggtgatggtggatgacagactagtgaccatgcag atttgggacacggcgggacaggagcggttccagtccctgggcgtggccttctacagaggc gccgactgctgcgtcctggtgttcgacgtgaccgcccccaacacgttcaagacccttgac agctggagagacgagtttctcatccaggccagtccccgggaccccgagaacttccccttt gtcgtgctgggaaacaagattgacctcgaaaacagacaggtggccaccaagcgggcacag gcctggtgctacagcaaaaacaacattccctacttcgagaccagcgccaaggaggccatc aacgtggagcaggccttccagacgattgcccggaatgcgctcaagcaggaaacggaagtg gagctgtacaacgagttccccgagcccatcaaactggacaagaacgaccgcaccaagccc tcggccgagggctgcagttgctga

DBGET integrated database retrieval system