Brassica rapa (field mustard): 103845345 Help Entry 103845345         CDS       T03449                                  Name (RefSeq) elongin-C isoform X2   KO K03872   elongin-C Organism brp  Brassica rapa (field mustard) Pathway brp04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:brp00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     103845345  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:brp04121]     103845345    03400 DNA repair and recombination proteins [BR:brp03400]     103845345 Ubiquitin system [BR:brp04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      103845345    Cul5 complex      103845345 DNA repair and recombination proteins [BR:brp03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      103845345 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ BTB Motif Other DBs NCBI-GeneID:  103845345 NCBI-ProteinID:  XP_009120429 UniProt:  M4CEF7 LinkDB All DBs Position A10:12951721..12954041 Genome browser AA seq 96 aa AA seqDB search MRETVKLISMEGFEFVIDREAAMVSQTIRSMLTSPGGFSESKEGVVTFPDISTTILEKIC QYFYWSIQYSRGKETEFHIEPELTLELMMAANYLHT NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgagagagacggtgaagttgataagcatggagggtttcgagttcgtgatcgacagggaa gccgccatggtttctcagacaatccgaagcatgctcacttctccaggtgggttctcggaa tcgaaagaaggcgtggtgactttccctgatatcagcactacaattctagagaagatctgt cagtacttctattggtctattcaatactccagaggcaaagagaccgagttccacatcgag cctgagttgaccttggagctgatgatggctgctaattatcttcacacttga

DBGET integrated database retrieval system