Bos taurus (cow): 281806 Help Entry 281806            CDS       T01008                                  Symbol GSTP1 Name (RefSeq) glutathione S-transferase P   KO K23790   glutathione S-transferase P [EC:2.5.1.18] Organism bta  Bos taurus (cow) Pathway bta00480   Glutathione metabolism bta00980   Metabolism of xenobiotics by cytochrome P450 bta00982   Drug metabolism - cytochrome P450 bta00983   Drug metabolism - other enzymes bta01100   Metabolic pathways bta01524   Platinum drug resistance bta05200   Pathways in cancer bta05204   Chemical carcinogenesis - DNA adducts bta05215   Prostate cancer bta05225   Hepatocellular carcinoma bta05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bta00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     281806 (GSTP1)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     281806 (GSTP1)    00982 Drug metabolism - cytochrome P450     281806 (GSTP1)    00983 Drug metabolism - other enzymes     281806 (GSTP1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     281806 (GSTP1)    05204 Chemical carcinogenesis - DNA adducts     281806 (GSTP1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     281806 (GSTP1)    05215 Prostate cancer     281806 (GSTP1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     281806 (GSTP1)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     281806 (GSTP1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:bta02000]     281806 (GSTP1) Enzymes [BR:bta01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      281806 (GSTP1) Transporters [BR:bta02000]  Other transporters   Pores ion channels [TC:1]    281806 (GSTP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_2 GST_N_2 GST_N_3 Motif Other DBs NCBI-GeneID:  281806 NCBI-ProteinID:  NP_803482 BGD-bta:  BT23695 Ensembl:  ENSBTAG00000051210 UniProt:  P28801 LinkDB All DBs Position 29:45441917..45444788 Genome browser AA seq 210 aa AA seqDB search MPPYTIVYFPVQGRCEAMRMLLADQGQSWKEEVVAMQSWLQGPLKASCLYGQLPKFQDGD LTLYQSNAILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKEDYV KALPQHLKPFETLLSQNKGGQAFIVGDQISFADYNLLDLLRIHQVLAPSCLDSFPLLSAY VARLNSRPKLKAFLASPEHMNRPINGNGKQ NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgcctccctacaccatcgtctacttcccggttcaagggcgctgcgaggccatgcgcatg ctgctggccgaccagggccagagctggaaggaggaggtcgtagccatgcagagctggctg cagggcccactcaaggcctcctgcctgtacgggcagctccccaagttccaggacggagac ctcacgctgtaccagtccaatgccatcctgcggcacctgggccgcaccctcgggctgtat gggaaggaccagcaggaggcggccctggtggacatggtgaatgacggtgtagaggacctt cgctgcaaatacgtctccctcatttacaccaactacgaggcgggcaaggaggactatgtg aaggcgctgccccagcacctgaagcctttcgagaccctgctgtcccagaacaagggtggc caggccttcatcgtgggcgaccagatctcctttgcggactacaacctgctggacctgctt cggattcaccaggtcctggcccccagctgtctggactccttccccctgctctcagcctac gtggcccgtctcaactcccggcccaagctcaaggccttcctggcctcccccgagcacatg aaccggcccatcaacggcaatgggaaacagtga

DBGET integrated database retrieval system