Budorcas taxicolor (takin): 128044360 Help Entry 128044360         CDS       T08909                                  Name (RefSeq) histone H2B type 2-F   KO K11252   histone H2B Organism btax  Budorcas taxicolor (takin) Pathway btax04613   Neutrophil extracellular trap formation btax05034   Alcoholism btax05203   Viral carcinogenesis btax05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:btax00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     128044360  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     128044360   09163 Immune disease    05322 Systemic lupus erythematosus     128044360   09165 Substance dependence    05034 Alcoholism     128044360  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:btax03036]     128044360   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:btax04147]     128044360 Chromosome and associated proteins [BR:btax03036]  Eukaryotic type   Nucleosome assembly factors    Histones     128044360 Exosome [BR:btax04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128044360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF6246 Motif Other DBs NCBI-GeneID:  128044360 NCBI-ProteinID:  XP_052492490 LinkDB All DBs Position 3:21157507..21166164 Genome browser AA seq 126 aa AA seqDB search MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccggatccagcaaaatccgctcctgctcctaaaaaaggttctaagaaagctgtcacg aaagtgcagaagaaggatggcaagaagcgcaagcgcagccgcaaggagagctattccgtt tacgtgtataaggtgctgaaacaggtacacccggacaccggcatctcgtccaaggccatg ggcatcatgaattccttcgtcaatgacatcttcgagcgcattgccggcgaagcgtcgcgt ctggcgcattacaacaagcgctcaaccattacttctcgagagatccagacggcggtgcgc ctgctgcttcctggtgagctggccaagcacgccgtgtccgagggcaccaaggcggtcacc aagtacaccagttcaaaatga

DBGET integrated database retrieval system