Citrobacter arsenatis: E1B03_03925 Help Entry E1B03_03925       CDS       T07503                                  Symbol holC Name (GenBank) DNA polymerase III subunit chi   KO K02339   DNA polymerase III subunit chi [EC:2.7.7.7] Organism cars  Citrobacter arsenatis Pathway cars03030   DNA replication cars03430   Mismatch repair cars03440   Homologous recombination Brite KEGG Orthology (KO) [BR:cars00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     E1B03_03925 (holC)    03430 Mismatch repair     E1B03_03925 (holC)    03440 Homologous recombination     E1B03_03925 (holC)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:cars03032]     E1B03_03925 (holC)    03400 DNA repair and recombination proteins [BR:cars03400]     E1B03_03925 (holC) Enzymes [BR:cars01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      E1B03_03925 (holC) DNA replication proteins [BR:cars03032]  Prokaryotic type   DNA Replication Elongation Factors    Elongation factors (bacterial)     DNA polymerase III holoenzyme      E1B03_03925 (holC) DNA repair and recombination proteins [BR:cars03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA polymerase III holoenzyme      E1B03_03925 (holC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol3_chi Motif Other DBs NCBI-ProteinID:  QBM21616 UniProt:  A0A4P6WIA3 LinkDB All DBs Position complement(618440..618883) Genome browser AA seq 147 aa AA seqDB search MRNATFYILDNDNTVDGLSAVEQLVCEIAAERWRAGKRVLIACENEKQALRLDEALWARP AESFVPHNLAGEGPRGGAPVEIAWPEKRNSSPRDLLISLRVGFADFATAFTEVIDFVPYE DSLKQSARDRYKAYRVAGFNLNTATWK NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgagaaacgcaacgttctatattctggacaatgacaacaccgtcgatggcttaagcgcc gtcgagcaactggtgtgtgaaattgccgcagaacgttggcgggctggcaagcgcgtgctg atcgcctgcgaaaacgaaaagcaggctcttcgactggatgaagccctgtgggcaagaccg gcagaaagctttgttccgcataatctggcgggcgaaggccccagaggcggcgcgccggta gaaattgcctggccggagaaacgtaacagcagcccgcgcgacctgctgatcagtttgcgc gttggctttgcagattttgccaccgctttcacagaagtgatagacttcgttccttacgaa gattctttgaaacaatcggcacgcgatcgctacaaagcttaccgcgtggctggttttaac ctgaatacggcaacctggaaataa

DBGET integrated database retrieval system