Camelus bactrianus (Bactrian camel): 105071777 Help Entry 105071777         CDS       T07534                                  Name (RefSeq) histone H2B type 2-F   KO K11252   histone H2B Organism cbai  Camelus bactrianus (Bactrian camel) Pathway cbai04613   Neutrophil extracellular trap formation cbai05034   Alcoholism cbai05203   Viral carcinogenesis cbai05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cbai00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105071777  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     105071777   09163 Immune disease    05322 Systemic lupus erythematosus     105071777   09165 Substance dependence    05034 Alcoholism     105071777  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cbai03036]     105071777   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cbai04147]     105071777 Chromosome and associated proteins [BR:cbai03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105071777 Exosome [BR:cbai04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105071777 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF6246 Motif Other DBs NCBI-GeneID:  105071777 NCBI-ProteinID:  XP_010956834 UniProt:  A0A9W3EV39 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSKWTLEVTASSAH NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgccggatccagcgaaatctgctcctgctcccaagaaaggctccaagaaagctgtcacg aaagtgcagaagaaggacggtaaaaaacgcaagcgcagccgcaaggagagctattccgtt tacgtgtacaaggtgctgaagcaggtgcatccggacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaagcgtcccgc ctggcgcactacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggtaccaaggccgtcacc aagtacaccagttcgaagtggaccctggaggtgactgcaagctcagctcattag

DBGET integrated database retrieval system