Corvus brachyrhynchos (American crow): 103612835 Help Entry 103612835         CDS       T08418                                  Symbol CST3 Name (RefSeq) cystatin-C   KO K13899   cystatin-C Organism cbrc  Corvus brachyrhynchos (American crow) Brite KEGG Orthology (KO) [BR:cbrc00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:cbrc01002]     103612835 (CST3)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cbrc04147]     103612835 (CST3) Peptidases and inhibitors [BR:cbrc01002]  Peptidase inhibitors   Family I25: cystatin family    103612835 (CST3) Exosome [BR:cbrc04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    103612835 (CST3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cystatin Motif Other DBs NCBI-GeneID:  103612835 NCBI-ProteinID:  XP_008628768 LinkDB All DBs Position Unknown AA seq 88 aa AA seqDB search MTAYNRASNDMYTSRVVRIISAKRQIVAGVKYIMEVEIARTTCTKPATDIQHCAFHEAPQ MAKHTICNFVVLNVPWRNQVELLESKCQ NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgacggcgtacaacagggccagcaacgacatgtacaccagccgggtggtgcgcatcatc agcgccaagaggcagatcgtggctggagtcaagtacataatggaagtggagattgcccgg acaacctgcacaaagccagcaactgatatccagcactgtgctttccatgaggcgccccag atggccaagcacaccatttgcaacttcgtagtgttgaatgttccttggcgaaaccaagtg gagctgctggagagcaagtgccagtaa

DBGET integrated database retrieval system