Cervus canadensis (wapiti): 122428615 Help Entry 122428615         CDS       T07554                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism ccad  Cervus canadensis (wapiti) Pathway ccad04146   Peroxisome ccad04213   Longevity regulating pathway - multiple species ccad05012   Parkinson disease ccad05014   Amyotrophic lateral sclerosis ccad05016   Huntington disease ccad05020   Prion disease ccad05022   Pathways of neurodegeneration - multiple diseases ccad05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:ccad00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     122428615 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     122428615 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     122428615 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     122428615 (SOD1)    05014 Amyotrophic lateral sclerosis     122428615 (SOD1)    05016 Huntington disease     122428615 (SOD1)    05020 Prion disease     122428615 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     122428615 (SOD1) Enzymes [BR:ccad01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      122428615 (SOD1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  122428615 NCBI-ProteinID:  XP_043304559 LinkDB All DBs Position 27:complement(3042299..3050826) Genome browser AA seq 152 aa AA seqDB search MATKAVCVLKGDGPVQGTIRFEAKGHTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAG PHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAKVDIVDSLISLSGEHSIIGRTMVVHE KPDDLGRGGNEESTKTGNAGNRLACGVIGIAQ NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atggcgacgaaggccgtctgcgtgctgaagggcgacggcccggtgcaaggcaccatccgc ttcgaggcaaagggacatacagtcgtcgtaactggatccatcacaggattgactgaaggt gatcatggattccacgtccatcagtttggagacaatacgcaaggctgtaccagtgcaggt cctcactttaatcctctgtccaaaaaacacggtgggccaaaagatgaagagaggcatgtt ggagacctgggcaacgtgacggctgacaaaaacggtgttgccaaagtggatattgtagat tctctgatctcactgtcaggagaacattccatcattggccgcacgatggtggtccatgaa aaaccagatgacttgggcagaggtggaaatgaagaaagtacaaagactggaaacgctgga aatcgtttggcctgtggtgtaattggaattgcccagtaa

DBGET integrated database retrieval system