Castor canadensis (American beaver): 109700071 Help Entry 109700071         CDS       T04791                                  Symbol Sod1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism ccan  Castor canadensis (American beaver) Pathway ccan04146   Peroxisome ccan04213   Longevity regulating pathway - multiple species ccan05012   Parkinson disease ccan05014   Amyotrophic lateral sclerosis ccan05016   Huntington disease ccan05020   Prion disease ccan05022   Pathways of neurodegeneration - multiple diseases ccan05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:ccan00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     109700071 (Sod1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     109700071 (Sod1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     109700071 (Sod1)   09164 Neurodegenerative disease    05012 Parkinson disease     109700071 (Sod1)    05014 Amyotrophic lateral sclerosis     109700071 (Sod1)    05016 Huntington disease     109700071 (Sod1)    05020 Prion disease     109700071 (Sod1)    05022 Pathways of neurodegeneration - multiple diseases     109700071 (Sod1) Enzymes [BR:ccan01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      109700071 (Sod1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  109700071 NCBI-ProteinID:  XP_020040678 UniProt:  A0A250YAD3 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MATKAVCVLKGDGSVQGTVHFEQKANGPVVVRGRITGLTEGLHGFHVHQFGDNTQGCTSA GPHFNPLSKKHGGPLDQERHVGDLGNVTANKDGVADVSIEDSLISLSGEHSIIGRTMVVH EKEDDLGKGGNDESTKTGNAGSRLACGVIGITQ NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggcgacgaaggccgtgtgcgtgctgaagggcgacggctcggtgcagggcaccgtccac ttcgagcagaaggcaaatgggccagttgtggtacggggacgcattacgggattgactgaa ggcctgcatggattccatgtccatcagtttggagataacactcaaggctgtaccagtgca ggtcctcactttaatcctctatccaaaaaacatggtgggccactggatcaggagaggcat gttggagacctgggcaatgtgactgctaacaaagatggcgtggctgatgtgtccattgaa gattctctgatctcactctcaggagagcattccatcattggccgtacaatggtggtccat gaaaaggaggatgacttgggcaaaggtggaaatgatgaaagtacaaagacaggaaatgct ggaagtcgtttggcttgtggagtaattgggatcacccagtaa

DBGET integrated database retrieval system