Cyprinus carpio (common carp): 109050034 Help Entry 109050034         CDS       T05134                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism ccar  Cyprinus carpio (common carp) Pathway ccar04060   Cytokine-cytokine receptor interaction ccar04218   Cellular senescence ccar04620   Toll-like receptor signaling pathway ccar04621   NOD-like receptor signaling pathway ccar04622   RIG-I-like receptor signaling pathway ccar05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccar00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109050034  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     109050034  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109050034    04621 NOD-like receptor signaling pathway     109050034    04622 RIG-I-like receptor signaling pathway     109050034  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109050034  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccar04052]     109050034    00536 Glycosaminoglycan binding proteins [BR:ccar00536]     109050034 Cytokines and neuropeptides [BR:ccar04052]  Cytokines   Chemokines    109050034 Glycosaminoglycan binding proteins [BR:ccar00536]  Heparan sulfate / Heparin   Chemokines    109050034 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  109050034 NCBI-ProteinID:  XP_018923247 UniProt:  A0A8C1MSJ2 LinkDB All DBs Position 48:complement(18072178..18078736) Genome browser AA seq 99 aa AA seqDB search MNTFLMLTIIGVSIVLSDALQPLGAGYNSRCVCLKLESRIIPQENLRRVEILPRGPHCKT TEVIAGLSSGKRICLNPRTPWVKKLILFIERKERVTKKV NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaacactttcctgatgttaaccataattggagtcagcatcgttctgtctgatgccttg cagcctctgggtgcgggttacaacagccgctgtgtgtgtctgaaactggagtcgcggatc atcccgcaagagaacctgcggcgcgtggagatcctgccaagaggcccacactgcaaaact actgaggttattgctggtttatcgagtggaaagaggatctgtctgaaccccaggacaccg tgggttaaaaaactcattctcttcattgagagaaaggagcgagtgaccaagaaagtttag

DBGET integrated database retrieval system