Camelus dromedarius (Arabian camel): 105097863 Help Entry 105097863         CDS       T04642                                  Name (RefSeq) C-C motif chemokine 4   KO K12964   C-C motif chemokine 4 Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04060   Cytokine-cytokine receptor interaction cdk04061   Viral protein interaction with cytokine and cytokine receptor cdk04062   Chemokine signaling pathway cdk04064   NF-kappa B signaling pathway cdk04620   Toll-like receptor signaling pathway cdk04623   Cytosolic DNA-sensing pathway cdk05163   Human cytomegalovirus infection Brite KEGG Orthology (KO) [BR:cdk00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     105097863   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105097863    04061 Viral protein interaction with cytokine and cytokine receptor     105097863  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105097863    04623 Cytosolic DNA-sensing pathway     105097863    04062 Chemokine signaling pathway     105097863  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     105097863  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cdk04052]     105097863 Cytokines and neuropeptides [BR:cdk04052]  Cytokines   Chemokines    105097863 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  105097863 NCBI-ProteinID:  XP_010988801 UniProt:  A0A5N4D2G8 LinkDB All DBs Position 16:12126527..12128692 Genome browser AA seq 92 aa AA seqDB search MKLCVTVLSLLVLLAAFCSPALSAPMGSDPPTSCCFSYAQRKLPRNFVMDYYETSSLCSQ PAVVFQTKKGRQVCANPSESWVQEYVDDLELN NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaagctctgcgtgactgtcctctccctcctcgtgctgctggctgccttctgctctccc gcactctcagcaccaatgggctcagaccctcccacttcctgctgcttctcttacgcccag cggaagcttcctcgcaacttcgtgatggattactatgagaccagcagcctctgctcccag ccagccgtggtattccaaaccaaaaagggcaggcaggtgtgtgccaaccccagcgagtcc tgggtccaggagtacgtggatgacctggaactgaactga

DBGET integrated database retrieval system