Camelus ferus (Wild Bactrian camel): 102520902 Help Entry 102520902         CDS       T02979                                  Name (RefSeq) histone H2B type 2-F isoform X13   KO K11252   histone H2B Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04613   Neutrophil extracellular trap formation cfr05034   Alcoholism cfr05203   Viral carcinogenesis cfr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cfr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102520902  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102520902   09163 Immune disease    05322 Systemic lupus erythematosus     102520902   09165 Substance dependence    05034 Alcoholism     102520902  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cfr03036]     102520902   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfr04147]     102520902 Chromosome and associated proteins [BR:cfr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102520902 Exosome [BR:cfr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102520902 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF6246 Motif Other DBs NCBI-GeneID:  102520902 NCBI-ProteinID:  XP_006195500 UniProt:  A0A8B6YRE9 LinkDB All DBs Position 21:25442884..25498514 Genome browser AA seq 128 aa AA seqDB search MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSKMQ NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgccggatccagcgaaatctgctcctgctcccaagaaaggctccaagaaagctgtcacg aaagtgcagaagaaggacggtaaaaaacgcaagcgcagccgcaaggagagctattccgtt tacgtgtacaaggtgctgaagcaggtgcatccggacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaagcgtcccgc ctggcgcactacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggtaccaaggccgtcacc aagtacaccagttcgaagatgcagtaa

DBGET integrated database retrieval system