Cricetulus griseus (Chinese hamster): 100757872 Help Entry 100757872         CDS       T02813                                  Symbol Eloc Name (RefSeq) elongin-C   KO K03872   elongin-C Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge04066   HIF-1 signaling pathway cge04120   Ubiquitin mediated proteolysis cge05170   Human immunodeficiency virus 1 infection cge05200   Pathways in cancer cge05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:cge00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     100757872 (Eloc)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     100757872 (Eloc)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100757872 (Eloc)   09162 Cancer: specific types    05211 Renal cell carcinoma     100757872 (Eloc)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100757872 (Eloc)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cge04121]     100757872 (Eloc)    03400 DNA repair and recombination proteins [BR:cge03400]     100757872 (Eloc) Ubiquitin system [BR:cge04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      100757872 (Eloc)    Cul5 complex      100757872 (Eloc) DNA repair and recombination proteins [BR:cge03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      100757872 (Eloc) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  100757872 NCBI-ProteinID:  XP_027254604 UniProt:  G3H9C9 LinkDB All DBs Position 2:144358558..144372425 Genome browser AA seq 112 aa AA seqDB search MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggatggagaggagaaaacctatggtggctgtgaaggccctgatgccatgtatgtcaag ttaatatcttctgatggccatgaatttattgtaaaaagagaacatgcattaacatcagga acaataaaggccatgttgagtggaccagggcagtttgctgagaatgaaaccaacgaggtc aattttagagagatcccttcgcacgtgctatcgaaagtctgcatgtatttcacctacaag gtccgctacactaacagctccaccgagattcctgaattcccaattgcacctgaaattgca ctggaactgctgatggctgcgaacttcctagattgttaa

DBGET integrated database retrieval system