Cottoperca gobio: 115015172 Help Entry 115015172         CDS       T07513                                  Name (RefSeq) thymosin beta-like   KO K05764   thymosin, beta 4 Organism cgob  Cottoperca gobio Pathway cgob04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:cgob00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     115015172  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cgob04812]     115015172 Cytoskeleton proteins [BR:cgob04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Thymosin      115015172 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thymosin DUF4522 WH2 Motif Other DBs NCBI-GeneID:  115015172 NCBI-ProteinID:  XP_029298263 UniProt:  A0A6J2QIN2 LinkDB All DBs Position 10:complement(17870644..17872360) Genome browser AA seq 45 aa AA seqDB search MSDKPDMTEIARFDKAKLKKTETKEKNPLPTKETIEQERKGDATP NT seq 138 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaagcccgacatgacagagatcgcccgtttcgacaaggcaaagctgaagaag acagagacaaaagaaaaaaaccctctgcccaccaaagagaccatcgagcaagagaggaaa ggcgatgccacaccttga

DBGET integrated database retrieval system