Cyclopterus lumpus (lumpfish): 117749818 Help Entry 117749818         CDS       T09199                                  Symbol eloca Name (RefSeq) elongin C paralog a   KO K03872   elongin-C Organism clum  Cyclopterus lumpus (lumpfish) Pathway clum04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:clum00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     117749818 (eloca)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:clum04121]     117749818 (eloca)    03400 DNA repair and recombination proteins [BR:clum03400]     117749818 (eloca) Ubiquitin system [BR:clum04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      117749818 (eloca)    Cul5 complex      117749818 (eloca) DNA repair and recombination proteins [BR:clum03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      117749818 (eloca) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ ADAMTS_CR_3 Cofilin_ADF Motif Other DBs NCBI-GeneID:  117749818 NCBI-ProteinID:  XP_034416484 LinkDB All DBs Position 20:complement(10042324..10044898) Genome browser AA seq 115 aa AA seqDB search MDGEERTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGEDLTIAENET NEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atggacggtgaagagagaacctacggtggctgtgaggggccagatgccatgtatgtgaaa ctgatctcttcagatggtcatgaatttattgtgaaaagagaacatgctttgacatctggg actatcaaagccatgttaagcggaccaggtgaggatttgacaattgctgaaaatgaaacc aacgaagtgaacttcagggagattccctctcacgtcctgtccaaggtctgcatgtacttc acctacaaggtccgctacaccaacagctccacagaaatacctgaattccccatcgctccg gagatcgccctggagctgctcatggctgcaaactttttggattgctaa

DBGET integrated database retrieval system